Support American Whitewater! Support American Whitewater!

[please login to make this ad block disappear]
Path: » The Playak Factor » Wilderness Systems » 2017
Year: 2007 - 2008 - 2009 - 2010 - 2011 - 2012 - 2013 - 2014 - 2015 - 2016 - 2017 - 2018 - 2019 - 2020 - 2021 - 2022 - 2023 - 2024 - 2025
Month: Jan - Feb - Mar - Apr - May - Jun - Jul - Aug - Sep - Oct - Nov - Dec
Discipline: All - Whitewater Kayak - SUP - Fish

Who's talking about you? The Playak Factor tracks the online attention for paddling athletes and brands by scanning more than 1500 paddling sites for your personal names and brand names, and weighing the matches by site importance, clicks and text position.

The Playak Factor - Wilderness Systems 2017

Wilderness Systems

No access to full details

You do not have access to full information about Wilderness Systems. To get access to these details, you can 'claim' the listing. To do so, please log in first.


Playak Factor 2017: 0 points.

Relative: 0.0% of top scorer. Average: 0.0 points per day.

Date Category Site Headlines
Dec 30 Social ... ...
Dec 30 Social ... ...
Dec 30 Social ... ...
Dec 30 Social ... ...
Dec 30 Social ... ...
Dec 29 Social ... ...
Dec 29 Social ... ...
Dec 29 Social ... ...
Dec 28 Social ... ...
Dec 28 Social ... ...
Dec 28 Social ... ...
Dec 28 Social ... ...
Dec 28 Social ... ...
Dec 27 Social ... ...
Dec 27 Social ... ...
Dec 27 Social ... ...
Dec 27 Social ... ...
Dec 27 Social ... ...
Dec 27 Social ... ...
Dec 27 Social ... ...
Dec 27 Social ... ...
Dec 27 Social ... ...
Dec 26 Social ... ...
Dec 26 Social ... ...
Dec 26 Social ... ...
Dec 26 Social ... ...
Dec 26 Social ... ...
Dec 26 Social ... ...
Dec 25 Videos ... ...
Dec 25 Social ... ...
Dec 24 Social ... ...
Dec 24 Videos ... ...
Dec 24 Social ... ...
Dec 24 Social ... ...
Dec 24 Forums ... ...
Dec 24 Social ... ...
Dec 24 Social ... ...
Dec 24 Social ... ...
Dec 23 Social ... ...
Dec 23 Videos ... ...
Dec 23 Social ... ...
Dec 23 Social ... ...
Dec 23 Social ... ...
Dec 23 Social ... ...
Dec 23 Social ... ...
Dec 23 Social ... ...
Dec 22 Social ... ...
Dec 22 Social ... ...
Dec 22 Social ... ...
Dec 22 Social ... ...
Dec 21 Social ... ...
Dec 21 Videos ... ...
Dec 20 Social ... ...
Dec 20 Social ... ...
Dec 19 Social ... ...
Dec 19 Social ... ...
Dec 19 Social ... ...
Dec 18 Social ... ...
Dec 18 Social ... ...
Dec 18 Social ... ...
Dec 17 Social ... ...
Dec 17 Social ... ...
Dec 17 Social ... ...
Dec 17 Social ... ...
Dec 17 Social ... ...
Dec 17 Social ... ...
Dec 17 Social ... ...
Dec 16 Social ... ...
Dec 16 Social ... ...
Dec 16 Social ... ...
Dec 16 Social ... ...
Dec 16 Social ... ...
Dec 16 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Videos ... ...
Dec 15 Videos ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Social ... ...
Dec 15 Videos ... ...
Dec 14 Social ... ...
Dec 14 Social ... ...
Dec 14 Forums ... ...
Dec 14 Social ... ...
Dec 14 Social ... ...
Dec 14 Social ... ...
Dec 14 Social ... ...
Dec 14 Social ... ...
Dec 14 Social ... ...
Dec 13 Social ... ...
Dec 13 Social ... ...
Dec 13 Videos ... ...
Dec 13 Social ... ...
Dec 13 Social ... ...
Dec 12 Social ... ...
Dec 12 Social ... ...
Dec 12 Social ... ...
Dec 11 Social ... ...
Dec 11 Social ... ...
Dec 11 Social ... ...
Dec 11 Social ... ...
Dec 11 Social ... ...
Dec 11 Social ... ...
Dec 11 Social ... ...
Dec 10 Videos ... ...
Dec 10 Social ... ...
Dec 10 Social ... ...
Dec 9 Social ... ...
Dec 9 Social ... ...
Dec 8 Social ... ...
Dec 8 Social ... ...
Dec 8 Social ... ...
Dec 8 Social ... ...
Dec 8 Social ... ...
Dec 7 Social ... ...
Dec 7 Videos ... ...
Dec 7 Social ... ...
Dec 7 Social ... ...
Dec 6 Social ... ...
Dec 6 Social ... ...
Dec 6 Social ... ...
Dec 6 Social ... ...
Dec 6 Social ... ...
Dec 6 Social ... ...
Dec 5 Forums ... ...
Dec 5 Social ... ...
Dec 5 Social ... ...
Dec 5 Social ... ...
Dec 4 Social ... ...
Dec 4 Social ... ...
Dec 4 Social ... ...
Dec 4 Social ... ...
Dec 4 Social ... ...
Dec 4 Social ... ...
Dec 4 Social ... ...
Dec 3 Social ... ...
Dec 3 Social ... ...
Dec 3 Social ... ...
Dec 3 Forums ... ...
Dec 3 Social ... ...
Dec 3 Forums ... ...
Dec 3 Social ... ...
Dec 3 Social ... ...
Dec 3 Social ... ...
Dec 2 Forums ... ...
Dec 2 Social ... ...
Dec 2 Social ... ...
Dec 2 Social ... ...
Dec 2 Forums ... ...
Dec 2 Social ... ...
Dec 2 Social ... ...
Dec 2 Social ... ...
Dec 2 Social ... ...
Dec 1 Videos ... ...
Dec 1 Social ... ...
Dec 1 Social ... ...
Dec 1 Forums ... ...
Dec 1 Social ... ...
Dec 1 Forums ... ...
Dec 1 Social ... ...
Nov 30 Social ... ...
Nov 30 Social ... ...
Nov 30 Social ... ...
Nov 30 Social ... ...
Nov 30 Social ... ...
Nov 30 Social ... ...
Nov 30 Social ... ...
Nov 29 Social ... ...
Nov 29 Social ... ...
Nov 29 Social ... ...
Nov 29 Social ... ...
Nov 29 Social ... ...
Nov 29 Social ... ...
Nov 29 Social ... ...
Nov 28 Social ... ...
Nov 28 Social ... ...
Nov 28 Social ... ...
Nov 28 Social ... ...
Nov 28 Social ... ...
Nov 28 Social ... ...
Nov 27 Social ... ...
Nov 27 Social ... ...
Nov 27 Social ... ...
Nov 27 Social ... ...
Nov 27 Social ... ...
Nov 27 Social ... ...
Nov 27 Social ... ...
Nov 26 Social ... ...
Nov 25 Social ... ...
Nov 25 Videos ... ...
Nov 25 Press ... ...
Nov 25 Social ... ...
Nov 25 Social ... ...
Nov 25 Social ... ...
Nov 25 Social ... ...
Nov 25 Social ... ...
Nov 24 Social ... ...
Nov 24 Social ... ...
Nov 23 Social ... ...
Nov 23 Social ... ...
Nov 23 Social ... ...
Nov 23 Social ... ...
Nov 22 Forums ... ...
Nov 22 Social ... ...
Nov 22 Forums ... ...
Nov 22 Forums ... ...
Nov 22 Social ... ...
Nov 22 Social ... ...
Nov 22 Social ... ...
Nov 22 Forums ... ...
Nov 22 Forums ... ...
Nov 21 Forums ... ...
Nov 21 Social ... ...
Nov 21 Forums ... ...
Nov 21 Forums ... ...
Nov 21 Social ... ...
Nov 20 Social ... ...
Nov 20 Social ... ...
Nov 20 Forums ... ...
Nov 19 Videos ... ...
Nov 19 Videos ... ...
Nov 19 Videos ... ...
Nov 19 Social ... ...
Nov 19 Social ... ...
Nov 19 Social ... ...
Nov 19 Social ... ...
Nov 19 Videos ... ...
Nov 19 Social ... ...
Nov 19 Social ... ...
Nov 19 Social ... ...
Nov 18 Social ... ...
Nov 18 Social ... ...
Nov 18 Social ... ...
Nov 18 Social ... ...
Nov 17 Videos ... ...
Nov 17 Videos ... ...
Nov 17 Social ... ...
Nov 17 Social ... ...
Nov 17 Social ... ...
Nov 16 Social ... ...
Nov 16 Social ... ...
Nov 16 Social ... ...
Nov 16 Social ... ...
Nov 16 Videos ... ...
Nov 15 Social ... ...
Nov 14 Social ... ...
Nov 14 Social ... ...
Nov 14 Social ... ...
Nov 14 Social ... ...
Nov 14 Social ... ...
Nov 13 Social ... ...
Nov 13 Social ... ...
Nov 13 Social ... ...
Nov 13 Videos ... ...
Nov 12 Social ... ...
Nov 12 Social ... ...
Nov 12 Social ... ...
Nov 12 Forums ... ...
Nov 12 Social ... ...
Nov 12 Social ... ...
Nov 12 Social ... ...
Nov 11 Social ... ...
Nov 11 Forums ... ...
Nov 11 Forums ... ...
Nov 11 Videos ... ...
Nov 11 Videos ... ...
Nov 11 Videos ... ...
Nov 11 Social ... ...
Nov 11 Social ... ...
Nov 11 Social ... ...
Nov 10 Social ... ...
Nov 10 Forums ... ...
Nov 10 Social ... ...
Nov 10 Social ... ...
Nov 10 Forums ... ...
Nov 9 Social ... ...
Nov 9 Social ... ...
Nov 9 Social ... ...
Nov 9 Social ... ...
Nov 9 Social ... ...
Nov 9 Social ... ...
Nov 8 Social ... ...
Nov 8 Social ... ...
Nov 8 Social ... ...
Nov 8 Social ... ...
Nov 8 Social ... ...
Nov 7 Social ... ...
Nov 7 Social ... ...
Nov 7 Social ... ...
Nov 7 Social ... ...
Nov 6 Social ... ...
Nov 6 Forums ... ...
Nov 6 Social ... ...
Nov 6 Social ... ...
Nov 6 Social ... ...
Nov 6 Social ... ...
Nov 5 Social ... ...
Nov 5 Social ... ...
Nov 5 Social ... ...
Nov 5 Social ... ...
Nov 5 Social ... ...
Nov 5 Social ... ...
Nov 5 Social ... ...
Nov 5 Social ... ...
Nov 5 Social ... ...
Nov 5 Social ... ...
Nov 4 Social ... ...
Nov 4 Social ... ...
Nov 4 Social ... ...
Nov 4 Social ... ...
Nov 4 Social ... ...
Nov 3 Social ... ...
Nov 3 Social ... ...
Nov 2 Social ... ...
Nov 2 Social ... ...
Nov 2 Social ... ...
Nov 2 Social ... ...
Nov 1 Social ... ...
Nov 1 Forums ... ...
Oct 31 Videos ... ...
Oct 31 Social ... ...
Oct 31 News ... ...
Oct 31 Social ... ...
Oct 30 Social ... ...
Oct 30 Social ... ...
Oct 30 Videos ... ...
Oct 30 Social ... ...
Oct 30 Social ... ...
Oct 30 Social ... ...
Oct 30 Social ... ...
Oct 30 News ... ...
Oct 29 Social ... ...
Oct 28 Social ... ...
Oct 28 Social ... ...
Oct 28 Social ... ...
Oct 28 Social ... ...
Oct 28 Social ... ...
Oct 28 Social ... ...
Oct 27 Social ... ...
Oct 27 Social ... ...
Oct 27 Social ... ...
Oct 26 Social ... ...
Oct 25 Videos ... ...
Oct 25 Social ... ...
Oct 25 Social ... ...
Oct 24 Social ... ...
Oct 24 Social ... ...
Oct 23 Social ... ...
Oct 23 Social ... ...
Oct 23 Social ... ...
Oct 23 Social ... ...
Oct 23 Social ... ...
Oct 23 Social ... ...
Oct 23 Social ... ...
Oct 22 Videos ... ...
Oct 22 Social ... ...
Oct 22 Forums ... ...
Oct 22 Social ... ...
Oct 22 Social ... ...
Oct 22 Social ... ...
Oct 22 Social ... ...
Oct 22 Social ... ...
Oct 22 Videos ... ...
Oct 22 Forums ... ...
Oct 21 Social ... ...
Oct 21 Social ... ...
Oct 21 Social ... ...
Oct 21 Social ... ...
Oct 21 Social ... ...
Oct 21 Social ... ...
Oct 20 Forums ... ...
Oct 20 Social ... ...
Oct 20 Social ... ...
Oct 20 Social ... ...
Oct 20 Social ... ...
Oct 19 Social ... ...
Oct 19 Social ... ...
Oct 19 Social ... ...
Oct 19 Social ... ...
Oct 19 Social ... ...
Oct 19 Social ... ...
Oct 19 Videos ... ...
Oct 18 Social ... ...
Oct 18 Social ... ...
Oct 18 Forums ... ...
Oct 18 Social ... ...
Oct 17 Social ... ...
Oct 17 Social ... ...
Oct 17 Social ... ...
Oct 17 Social ... ...
Oct 17 Social ... ...
Oct 17 Social ... ...
Oct 17 Social ... ...
Oct 16 Social ... ...
Oct 16 Social ... ...
Oct 16 Social ... ...
Oct 15 Social ... ...
Oct 15 Social ... ...
Oct 15 Social ... ...
Oct 15 Social ... ...
Oct 15 Social ... ...
Oct 15 Social ... ...
Oct 15 Social ... ...
Oct 14 Social ... ...
Oct 14 Videos ... ...
Oct 14 Social ... ...
Oct 14 Social ... ...
Oct 14 Social ... ...
Oct 14 Social ... ...
Oct 13 Social ... ...
Oct 13 Social ... ...
Oct 13 Social ... ...
Oct 13 Videos ... ...
Oct 13 Social ... ...
Oct 12 Social ... ...
Oct 12 Social ... ...
Oct 12 Social ... ...
Oct 11 Social ... ...
Oct 11 Social ... ...
Oct 11 Social ... ...
Oct 11 Social ... ...
Oct 11 Social ... ...
Oct 11 Social ... ...
Oct 10 Social ... ...
Oct 10 Social ... ...
Oct 10 Social ... ...
Oct 9 Social ... ...
Oct 9 Social ... ...
Oct 9 Social ... ...
Oct 9 Social ... ...
Oct 9 Social ... ...
Oct 9 Social ... ...
Oct 9 Social ... ...
Oct 9 Social ... ...
Oct 9 Social ... ...
Oct 8 Social ... ...
Oct 8 Videos ... ...
Oct 8 Social ... ...
Oct 8 Social ... ...
Oct 8 Videos ... ...
Oct 8 Social ... ...
Oct 8 Videos ... ...
Oct 8 Social ... ...
Oct 7 Social ... ...
Oct 7 Social ... ...
Oct 7 Social ... ...
Oct 7 Social ... ...
Oct 6 Social ... ...
Oct 6 Social ... ...
Oct 6 Social ... ...
Oct 6 Social ... ...
Oct 6 Social ... ...
Oct 6 Social ... ...
Oct 6 News ... ...
Oct 6 Social ... ...
Oct 5 Social ... ...
Oct 5 Social ... ...
Oct 5 Social ... ...
Oct 5 Social ... ...
Oct 5 Social ... ...
Oct 4 Social ... ...
Oct 4 Social ... ...
Oct 4 Social ... ...
Oct 3 Social ... ...
Oct 3 Social ... ...
Oct 3 Social ... ...
Oct 2 Social ... ...
Oct 2 Forums ... ...
Oct 2 Social ... ...
Oct 1 Social ... ...
Oct 1 Social ... ...
Oct 1 Social ... ...
Oct 1 Social ... ...
Oct 1 Social ... ...
Oct 1 Social ... ...
Oct 1 Social ... ...
Oct 1 Social ... ...
Sep 30 Forums ... ...
Sep 30 Social ... ...
Sep 30 Social ... ...
Sep 30 Social ... ...
Sep 29 Social ... ...
Sep 29 Social ... ...
Sep 29 Social ... ...
Sep 29 Social ... ...
Sep 28 Videos ... ...
Sep 28 Social ... ...
Sep 28 Social ... ...
Sep 28 Social ... ...
Sep 28 Social ... ...
Sep 28 Social ... ...
Sep 28 Social ... ...
Sep 27 Videos ... ...
Sep 27 Social ... ...
Sep 26 Social ... ...
Sep 26 Social ... ...
Sep 26 Social ... ...
Sep 26 Social ... ...
Sep 26 Social ... ...
Sep 26 Social ... ...
Sep 25 Social ... ...
Sep 25 Forums ... ...
Sep 25 Social ... ...
Sep 25 Social ... ...
Sep 25 Social ... ...
Sep 25 Social ... ...
Sep 25 Social ... ...
Sep 25 Social ... ...
Sep 25 Social ... ...
Sep 25 Social ... ...
Sep 24 Videos ... ...
Sep 24 Social ... ...
Sep 24 Social ... ...
Sep 23 Videos ... ...
Sep 23 Videos ... ...
Sep 23 Social ... ...
Sep 23 Social ... ...
Sep 22 Social ... ...
Sep 22 Social ... ...
Sep 22 Social ... ...
Sep 22 Social ... ...
Sep 22 Social ... ...
Sep 22 Forums ... ...
Sep 22 Social ... ...
Sep 22 Social ... ...
Sep 22 Social ... ...
Sep 22 Videos ... ...
Sep 21 Social ... ...
Sep 21 Social ... ...
Sep 20 Social ... ...
Sep 20 Social ... ...
Sep 20 Social ... ...
Sep 19 Social ... ...
Sep 19 Social ... ...
Sep 19 Videos ... ...
Sep 19 Social ... ...
Sep 18 Social ... ...
Sep 18 Social ... ...
Sep 18 Forums ... ...
Sep 18 Social ... ...
Sep 18 Social ... ...
Sep 18 Social ... ...
Sep 18 Social ... ...
Sep 17 Social ... ...
Sep 17 Social ... ...
Sep 17 Social ... ...
Sep 17 Social ... ...
Sep 17 Social ... ...
Sep 16 Forums ... ...
Sep 16 Social ... ...
Sep 16 Social ... ...
Sep 16 Social ... ...
Sep 16 Social ... ...
Sep 16 Social ... ...
Sep 16 Social ... ...
Sep 16 Social ... ...
Sep 16 Social ... ...
Sep 15 Forums ... ...
Sep 15 Forums ... ...
Sep 15 News ... ...
Sep 15 Forums ... ...
Sep 15 Forums ... ...
Sep 15 Forums ... ...
Sep 15 Forums ... ...
Sep 15 Social ... ...
Sep 15 Social ... ...
Sep 14 Social ... ...
Sep 14 Forums ... ...
Sep 14 Social ... ...
Sep 14 Social ... ...
Sep 14 Forums ... ...
Sep 14 Forums ... ...
Sep 13 Social ... ...
Sep 13 Social ... ...
Sep 13 Social ... ...
Sep 13 Social ... ...
Sep 13 Forums ... ...
Sep 13 Social ... ...
Sep 12 Social ... ...
Sep 12 Social ... ...
Sep 12 Social ... ...
Sep 12 Social ... ...
Sep 12 Social ... ...
Sep 12 Social ... ...
Sep 12 Social ... ...
Sep 12 Social ... ...
Sep 12 Social ... ...
Sep 11 Forums ... ...
Sep 11 Videos ... ...
Sep 11 Social ... ...
Sep 11 Social ... ...
Sep 11 Social ... ...
Sep 11 Social ... ...
Sep 11 Social ... ...
Sep 11 Social ... ...
Sep 11 Forums ... ...
Sep 11 Social ... ...
Sep 11 Social ... ...
Sep 10 Social ... ...
Sep 10 Social ... ...
Sep 10 Social ... ...
Sep 9 Forums ... ...
Sep 9 Social ... ...
Sep 9 Videos ... ...
Sep 9 Social ... ...
Sep 9 Social ... ...
Sep 9 Social ... ...
Sep 8 Social ... ...
Sep 8 Social ... ...
Sep 8 Social ... ...
Sep 8 Social ... ...
Sep 8 Social ... ...
Sep 8 Forums ... ...
Sep 8 Social ... ...
Sep 7 Social ... ...
Sep 7 Social ... ...
Sep 6 Social ... ...
Sep 6 Social ... ...
Sep 6 Videos ... ...
Sep 6 Social ... ...
Sep 6 Forums ... ...
Sep 6 Social ... ...
Sep 6 Social ... ...
Sep 6 Social ... ...
Sep 6 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 5 Social ... ...
Sep 4 Social ... ...
Sep 4 Social ... ...
Sep 4 Social ... ...
Sep 4 Social ... ...
Sep 4 Social ... ...
Sep 4 Social ... ...
Sep 4 Forums ... ...
Sep 4 Forums ... ...
Sep 4 Forums ... ...
Sep 4 Social ... ...
Sep 4 Social ... ...
Sep 4 Social ... ...
Sep 4 Forums ... ...
Sep 4 Forums ... ...
Sep 4 Social ... ...
Sep 4 Social ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 3 Videos ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 3 Forums ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 3 Social ... ...
Sep 2 Social ... ...
Sep 2 Videos ... ...
Sep 2 Social ... ...
Sep 2 Social ... ...
Sep 2 Social ... ...
Sep 2 Social ... ...
Sep 2 Social ... ...
Sep 2 Social ... ...
Sep 2 Social ... ...
Sep 2 Social ... ...
Sep 2 Social ... ...
Sep 1 Social ... ...
Sep 1 Social ... ...
Sep 1 Social ... ...
Sep 1 Social ... ...
Sep 1 Social ... ...
Sep 1 Social ... ...
Aug 31 Social ... ...
Aug 31 Videos ... ...
Aug 31 Videos ... ...
Aug 31 Videos ... ...
Aug 31 Social ... ...
Aug 31 Social ... ...
Aug 31 Press ... ...
Aug 31 Social ... ...
Aug 31 Videos ... ...
Aug 31 Forums ... ...
Aug 31 Social ... ...
Aug 31 Social ... ...
Aug 31 Social ... ...
Aug 31 Social ... ...
Aug 30 Social ... ...
Aug 30 Social ... ...
Aug 30 Forums ... ...
Aug 30 Social ... ...
Aug 30 Social ... ...
Aug 30 Social ... ...
Aug 30 Social ... ...
Aug 30 Social ... ...
Aug 30 Social ... ...
Aug 30 Social ... ...
Aug 30 Social ... ...
Aug 30 Videos ... ...
Aug 29 Forums ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 29 Social ... ...
Aug 28 Social ... ...
Aug 28 Social ... ...
Aug 28 Social ... ...
Aug 28 Social ... ...
Aug 28 Social ... ...
Aug 28 Social ... ...
Aug 28 Social ... ...
Aug 28 Social ... ...
Aug 28 Social ... ...
Aug 28 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 27 Social ... ...
Aug 26 Social ... ...
Aug 26 Social ... ...
Aug 26 Social ... ...
Aug 26 Social ... ...
Aug 26 Social ... ...
Aug 26 Social ... ...
Aug 26 Social ... ...
Aug 26 Social ... ...
Aug 26 Social ... ...
Aug 26 Social ... ...
Aug 26 Forums ... ...
Aug 26 Social ... ...
Aug 26 Social ... ...
Aug 25 Forums ... ...
Aug 25 Social ... ...
Aug 25 Social ... ...
Aug 25 Social ... ...
Aug 25 Social ... ...
Aug 25 Social ... ...
Aug 24 Social ... ...
Aug 24 Social ... ...
Aug 24 Social ... ...
Aug 24 Social ... ...
Aug 24 Social ... ...
Aug 24 Social ... ...
Aug 24 Social ... ...
Aug 24 Social ... ...
Aug 24 Social ... ...
Aug 23 Social ... ...
Aug 23 Social ... ...
Aug 23 Social ... ...
Aug 23 Social ... ...
Aug 23 Social ... ...
Aug 23 News ... ...
Aug 23 Social ... ...
Aug 23 Social ... ...
Aug 23 Videos ... ...
Aug 23 Social ... ...
Aug 22 Videos ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Videos ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Forums ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 22 Social ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 21 Videos ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 21 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 20 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Social ... ...
Aug 19 Forums ... ...
Aug 18 Social ... ...
Aug 18 Social ... ...
Aug 18 Social ... ...
Aug 18 Social ... ...
Aug 18 Social ... ...
Aug 18 Social ... ...
Aug 18 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 17 Videos ... ...
Aug 17 Social ... ...
Aug 17 Social ... ...
Aug 16 Forums ... ...
Aug 16 Videos ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 16 Social ... ...
Aug 15 Social ... ...
Aug 15 Social ... ...
Aug 15 Social ... ...
Aug 15 Social ... ...
Aug 15 Social ... ...
Aug 15 Social ... ...
Aug 15 Social ... ...
Aug 15 Social ... ...
Aug 15 Social ... ...
Aug 15 Social ... ...
Aug 15 Forums ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Forums ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 14 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 13 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 12 Social ... ...
Aug 11 Social ... ...
Aug 11 Social ... ...
Aug 11 Videos ... ...
Aug 11 Social ... ...
Aug 10 Social ... ...
Aug 10 Social ... ...
Aug 10 Social ... ...
Aug 10 Social ... ...
Aug 10 Social ... ...
Aug 10 Social ... ...
Aug 10 Social ... ...
Aug 10 Social ... ...
Aug 10 Social ... ...
Aug 10 Social ... ...
Aug 9 Social ... ...
Aug 9 Forums ... ...
Aug 9 Social ... ...
Aug 9 Social ... ...
Aug 9 Social ... ...
Aug 9 Social ... ...
Aug 9 Social ... ...
Aug 9 Social ... ...
Aug 9 Social ... ...
Aug 9 Social ... ...
Aug 8 Social ... ...
Aug 8 Social ... ...
Aug 8 Social ... ...
Aug 7 Social ... ...
Aug 7 Social ... ...
Aug 7 Videos ... ...
Aug 7 Social ... ...
Aug 7 Social ... ...
Aug 7 Social ... ...
Aug 7 Social ... ...
Aug 7 Social ... ...
Aug 7 Social ... ...
Aug 7 Social ... ...
Aug 7 Videos ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 6 Social ... ...
Aug 5 Social ... ...
Aug 5 Videos ... ...
Aug 5 Social ... ...
Aug 5 Social ... ...
Aug 5 Social ... ...
Aug 5 Social ... ...
Aug 5 Social ... ...
Aug 5 Social ... ...
Aug 5 Social ... ...
Aug 5 Videos ... ...
Aug 5 Social ... ...
Aug 4 Social ... ...
Aug 4 Social ... ...
Aug 4 Social ... ...
Aug 4 Social ... ...
Aug 4 Social ... ...
Aug 4 Social ... ...
Aug 4 Social ... ...
Aug 4 Forums ... ...
Aug 3 Social ... ...
Aug 3 Social ... ...
Aug 3 Social ... ...
Aug 2 Social ... ...
Aug 2 Social ... ...
Aug 2 Social ... ...
Aug 2 Social ... ...
Aug 2 Social ... ...
Aug 2 Videos ... ...
Aug 2 Social ... ...
Aug 2 Social ... ...
Aug 2 Social ... ...
Aug 2 Social ... ...
Aug 2 Social ... ...
Aug 2 Social ... ...
Aug 2 Forums ... ...
Aug 1 Videos ... ...
Aug 1 Social ... ...
Aug 1 Videos ... ...
Aug 1 Videos ... ...
Aug 1 Social ... ...
Aug 1 Social ... ...
Aug 1 Social ... ...
Aug 1 Social ... ...
Aug 1 Videos ... ...
Aug 1 Social ... ...
Aug 1 Social ... ...
Aug 1 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Forums ... ...
Jul 31 Forums ... ...
Jul 31 Forums ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 31 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Social ... ...
Jul 30 Forums ... ...
Jul 30 Social ... ...
Jul 29 Social ... ...
Jul 29 Social ... ...
Jul 29 Social ... ...
Jul 29 Social ... ...
Jul 29 Social ... ...
Jul 28 Forums ... ...
Jul 28 Forums ... ...
Jul 28 Social ... ...
Jul 28 Social ... ...
Jul 28 Social ... ...
Jul 28 Social ... ...
Jul 28 Social ... ...
Jul 28 Social ... ...
Jul 28 Social ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 27 Forums ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 27 Social ... ...
Jul 26 Social ... ...
Jul 26 Social ... ...
Jul 26 Social ... ...
Jul 26 Social ... ...
Jul 26 Social ... ...
Jul 26 Social ... ...
Jul 26 Social ... ...
Jul 26 Social ... ...
Jul 26 Social ... ...
Jul 25 Social ... ...
Jul 25 Social ... ...
Jul 24 Forums ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Forums ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 24 Social ... ...
Jul 23 Social ... ...
Jul 23 Social ... ...
Jul 23 Forums ... ...
Jul 23 Social ... ...
Jul 23 Social ... ...
Jul 23 Forums ... ...
Jul 23 Forums ... ...
Jul 23 Forums ... ...
Jul 23 Forums ... ...
Jul 23 Forums ... ...
Jul 23 Forums ... ...
Jul 23 Forums ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 22 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 21 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Forums ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 20 News ... ...
Jul 20 News ... ...
Jul 20 News ... ...
Jul 20 Social ... ...
Jul 20 Social ... ...
Jul 19 Social ... ...
Jul 19 Social ... ...
Jul 19 Social ... ...
Jul 19 Forums ... ...
Jul 19 Social ... ...
Jul 19 Social ... ...
Jul 19 Social ... ...
Jul 19 Social ... ...
Jul 19 Social ... ...
Jul 19 Social ... ...
Jul 19 Social ... ...
Jul 19 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 18 Social ... ...
Jul 17 Social ... ...
Jul 17 Social ... ...
Jul 17 Social ... ...
Jul 17 Social ... ...
Jul 17 Social ... ...
Jul 17 Social ... ...
Jul 17 Social ... ...
Jul 17 Social ... ...
Jul 17 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Videos ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 16 Social ... ...
Jul 15 Social ... ...
Jul 15 Social ... ...
Jul 15 Forums ... ...
Jul 15 Social ... ...
Jul 15 Social ... ...
Jul 15 Social ... ...
Jul 15 Social ... ...
Jul 14 Social ... ...
Jul 14 Social ... ...
Jul 14 Social ... ...
Jul 14 Social ... ...
Jul 13 Social ... ...
Jul 13 Social ... ...
Jul 13 Social ... ...
Jul 13 Social ... ...
Jul 13 Social ... ...
Jul 13 Social ... ...
Jul 13 Social ... ...
Jul 13 Social ... ...
Jul 13 Social ... ...
Jul 13 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Forums ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 12 Social ... ...
Jul 11 Social ... ...
Jul 11 Forums ... ...
Jul 11 Forums ... ...
Jul 11 Social ... ...
Jul 11 Social ... ...
Jul 11 Social ... ...
Jul 11 Social ... ...
Jul 11 Forums ... ...
Jul 11 Forums ... ...
Jul 11 Forums ... ...
Jul 11 Social ... ...
Jul 10 Forums ... ...
Jul 10 Social ... ...
Jul 10 Social ... ...
Jul 10 Social ... ...
Jul 10 Social ... ...
Jul 10 Social ... ...
Jul 10 Social ... ...
Jul 10 Social ... ...
Jul 9 Social ... ...
Jul 9 Social ... ...
Jul 9 Forums ... ...
Jul 9 Social ... ...
Jul 8 Social ... ...
Jul 8 Social ... ...
Jul 7 Forums ... ...
Jul 7 Forums ... ...
Jul 7 Social ... ...
Jul 7 Social ... ...
Jul 6 Social ... ...
Jul 6 Social ... ...
Jul 6 Social ... ...
Jul 6 Social ... ...
Jul 4 Forums ... ...
Jul 4 Social ... ...
Jul 4 Social ... ...
Jul 3 Social ... ...
Jul 3 Social ... ...
Jul 3 Social ... ...
Jul 2 Social ... ...
Jul 2 Social ... ...
Jul 1 Forums ... ...
Jul 1 Social ... ...
Jul 1 Social ... ...
Jun 30 Social ... ...
Jun 30 Social ... ...
Jun 30 Social ... ...
Jun 29 Videos ... ...
Jun 29 Social ... ...
Jun 29 Videos ... ...
Jun 29 Social ... ...
Jun 28 Social ... ...
Jun 28 Social ... ...
Jun 27 Forums ... ...
Jun 27 Forums ... ...
Jun 27 Forums ... ...
Jun 27 Forums ... ...
Jun 26 Forums ... ...
Jun 26 Social ... ...
Jun 26 Social ... ...
Jun 25 Social ... ...
Jun 25 Social ... ...
Jun 24 Social ... ...
Jun 23 Forums ... ...
Jun 23 Social ... ...
Jun 23 Social ... ...
Jun 21 Forums ... ...
Jun 21 Social ... ...
Jun 21 Social ... ...
Jun 21 Forums ... ...
Jun 21 Social ... ...
Jun 20 Social ... ...
Jun 20 Forums ... ...
Jun 20 Forums ... ...
Jun 20 Forums ... ...
Jun 19 Social ... ...
Jun 19 Social ... ...
Jun 18 Social ... ...
Jun 18 Social ... ...
Jun 18 Forums ... ...
Jun 16 Social ... ...
Jun 16 Social ... ...
Jun 14 Forums ... ...
Jun 14 Social ... ...
Jun 14 Social ... ...
Jun 13 Social ... ...
Jun 13 Videos ... ...
Jun 13 Forums ... ...
Jun 13 Social ... ...
Jun 12 Social ... ...
Jun 12 Social ... ...
Jun 12 Social ... ...
Jun 12 Social ... ...
Jun 11 Social ... ...
Jun 11 Social ... ...
Jun 11 Social ... ...
Jun 11 Social ... ...
Jun 11 Social ... ...
Jun 11 Social ... ...
Jun 11 Social ... ...
Jun 11 Social ... ...
Jun 11 Social ... ...
Jun 11 Social ... ...
Jun 10 Social ... ...
Jun 10 Social ... ...
Jun 10 Social ... ...
Jun 10 Social ... ...
Jun 10 Social ... ...
Jun 10 Social ... ...
Jun 10 Social ... ...
Jun 10 Social ... ...
Jun 10 Social ... ...
Jun 10 Social ... ...
Jun 10 Social ... ...
Jun 9 Social ... ...
Jun 9 Videos ... ...
Jun 9 Social ... ...
Jun 9 Social ... ...
Jun 9 Social ... ...
Jun 9 Social ... ...
Jun 9 Social ... ...
Jun 9 Social ... ...
Jun 9 Social ... ...
Jun 9 Social ... ...
Jun 8 Social ... ...
Jun 8 Social ... ...
Jun 8 Social ... ...
Jun 8 Social ... ...
Jun 8 Social ... ...
Jun 8 Social ... ...
Jun 8 Social ... ...
Jun 8 Social ... ...
Jun 8 Videos ... ...
Jun 7 Forums ... ...
Jun 7 Social ... ...
Jun 7 Social ... ...
Jun 7 Social ... ...
Jun 7 Social ... ...
Jun 7 Social ... ...
Jun 7 Social ... ...
Jun 6 Social ... ...
Jun 6 Social ... ...
Jun 6 Social ... ...
Jun 6 Social ... ...
Jun 6 Social ... ...
Jun 6 Social ... ...
Jun 6 Social ... ...
Jun 6 Social ... ...
Jun 5 Social ... ...
Jun 5 Social ... ...
Jun 5 Social ... ...
Jun 5 Social ... ...
Jun 5 Social ... ...
Jun 5 Social ... ...
Jun 5 Social ... ...
Jun 5 Social ... ...
Jun 5 Social ... ...
Jun 5 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 4 Social ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 3 Forums ... ...
Jun 3 Social ... ...
Jun 3 Social ... ...
Jun 2 Social ... ...
Jun 2 Social ... ...
Jun 2 Social ... ...
Jun 2 Social ... ...
Jun 2 Social ... ...
Jun 2 Social ... ...
Jun 2 Social ... ...
Jun 1 Social ... ...
Jun 1 Social ... ...
Jun 1 Social ... ...
Jun 1 Social ... ...
Jun 1 Videos ... ...
Jun 1 Social ... ...
Jun 1 Social ... ...
Jun 1 Social ... ...
Jun 1 Social ... ...
Jun 1 Social ... ...
Jun 1 Social ... ...
Jun 1 Videos ... ...
Jun 1 Social ... ...
May 31 Social ... ...
May 31 Social ... ...
May 31 Social ... ...
May 31 Social ... ...
May 31 Social ... ...
May 31 Social ... ...
May 31 Social ... ...
May 31 Social ... ...
May 31 Social ... ...
May 30 Social ... ...
May 30 Social ... ...
May 30 Social ... ...
May 30 Social ... ...
May 30 Social ... ...
May 30 Social ... ...
May 30 Social ... ...
May 30 Social ... ...
May 30 Social ... ...
May 30 Forums ... ...
May 30 Social ... ...
May 30 Social ... ...
May 29 Social ... ...
May 29 Social ... ...
May 29 Social ... ...
May 29 Social ... ...
May 29 Social ... ...
May 29 Social ... ...
May 29 Social ... ...
May 29 Social ... ...
May 29 Social ... ...
May 29 Social ... ...
May 29 Social ... ...
May 28 Social ... ...
May 28 Social ... ...
May 28 Forums ... ...
May 28 Social ... ...
May 28 Social ... ...
May 28 Social ... ...
May 28 Social ... ...
May 28 Social ... ...
May 28 Social ... ...
May 28 Videos ... ...
May 28 Social ... ...
May 27 Social ... ...
May 27 Social ... ...
May 27 Social ... ...
May 27 Social ... ...
May 27 Social ... ...
May 27 Social ... ...
May 27 Social ... ...
May 27 Social ... ...
May 26 Social ... ...
May 26 Social ... ...
May 26 Social ... ...
May 26 Forums ... ...
May 26 Forums ... ...
May 26 Social ... ...
May 26 Social ... ...
May 25 Social ... ...
May 25 Videos ... ...
May 25 Social ... ...
May 25 Social ... ...
May 25 Social ... ...
May 25 Social ... ...
May 25 Social ... ...
May 25 Social ... ...
May 25 Social ... ...
May 25 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Videos ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 24 Social ... ...
May 23 Social ... ...
May 23 Social ... ...
May 23 Social ... ...
May 23 Social ... ...
May 23 Social ... ...
May 23 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 22 Social ... ...
May 21 Social ... ...
May 21 Social Instagram Eastslope kayak classic qualifier. Good day on the water!! #kayak #kayaking #kayakfishing #fishing #spinfishing #fishing #wildernesssystemsradar135 #wildernesssystems #radar135 #wabamun #pike #pikefishing
May 21 Social Instagram Beautiful reflections. #monongahelariver #wernerpaddles #wildernesssystems #wildwonderful #kayakingadventures
May 21 Social Instagram Visiting our former haunts with @kristeen.young °° #anydayonthewaterisagoodday #wildernesssystems #kayaking #promisedlandstatepark
May 21 Social Instagram Calm water on Lake Superior #wildernesssystems #kayaking #kayakingadventures #perceptionkayaks #bendingbranches #stohlquist #optoutside
May 21 Social Instagram A bee-utiful day on the south fork. This girl crawled up my leg and we had a nice cruise while she dried off. She was eventually able to fly away:) #newriver #wildernesssystems #atpaddles #kayaking #beesplease #canthugeverybee #nc
May 21 Social Instagram @Yaktribe tournament fishing! #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #helixpd #wildy #wildernesssystems
May 21 Social Instagram Under a #train #trestle in a kayak. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape
May 21 Social Instagram Kajakpaddling i kilsbergen ☀️. #kilsbergen #kajakpaddling #ilovekayaking #kayakgram #wildernesssystems #thisisorebro
May 21 Social Wilderness Systems Fishing Kayaks FB Yeah, go ahead and fish the rapids! The 14-foot ATAK, is our smartest, most stable and performance-driven angling kayak to date. With endless storage opportunities, the ATAK lands you huge efficiency gains to prepare you for any fish at any time. Handcrafted in Greenville, SC and MADE IN THE USA. #WildyFishing #ATAK
May 21 Social Instagram Rain forest kayaking, Golfo Dulce, Osa Península, Costa Rica #junglekayaking #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing
May 21 Social Wilderness Systems Kayaks FB We aren't sure about you, but we aren't ready for this weekend to end! #WildernessSystemsKayaks
May 21 Social Instagram Getting the new whip ready to ride!! #wildernesssystems #wildernessmen #outdoors #weekendvibes #yakattack #tarpon120 #vapelyfe #waterfun #kayaking #kayakcamping
May 21 Social Instagram My new yak attack black pack has my back!!! #kayaking #kayakcamping #tarpon120 #waterfun #vapelyfe #wildernesssystems #wildernessmen #weekend #family #waterfun
May 21 Social Instagram #jacksonkayak #wildernesssystems #bigriveranglersassociation
May 21 Social Instagram Catfish on a rattletrap whhhhhaaaaa!!! #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #helixpd #texas #fish
May 21 Social Instagram #rainraingoaway #dontcomebackanotherday. #rainyday #rainyweek #bored #wishiwaskayaking #mn #lakes #kayaking #tarpon120 #wildernesssystems #wernerpaddles #aquabound #sunny #trees #water #life
May 21 Social Instagram Getting my Sunday #timberfit workout in. #13fishing #hawgtrough #basstournament #kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan #mysterytacklebox #mysterytackleboxpro #husqvarna #chainsaws @b3astridge @mi_fowl_play @mrwranglerstar
May 20 Social Instagram Nowhere I'd rather be on a sunny day . . . #kayak #kayaking #water #lake #paddle #paddlelife #summer #trees #nature #naturephoto #natureaddict #getoutside #getoutstayout #greatoutdoors @llbean @wildernesssystems
May 20 Social Instagram Paddling west at sunset to get home. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape #patagonia
May 20 Social Instagram ° . . #kayaking #kayak #wildernesssystems #optoutside #explore #adventure #herwanderfullife #womenwhoexplore #wappingerscreek #hudsonvalley #newyork #newyorkexplored #scenicny #visitvortex
May 20 Social Instagram Kayak fishing. Does it get any better?#hawgtrough #basstournament #kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan #mysterytacklebox #mysterytackleboxpro #katsmidwest #fishkats @b3astridge @mi_fowl_play @mi_lip_rippers @mikeiaconelli @flukemaster @kayakbassfishing
May 20 Social Instagram This bald eagle was flying above the St Joseph river as I was kayaking. I paddled upriver until I found where he had perched. #baldeagle #bald #eagle #eagles #raptor #photooftheday #kayaking #kayak #kayakphotography #talons #hunting #birdofprey #nikon #nikond810 #nikkor #nikkor70_200mm #staredown #eyes #nature #wildlife #wildernesssystems
May 20 Social Instagram Don't have the time to #portage Now but I'd like to see how much further I could go. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape
May 20 Social Wilderness Systems Fishing Kayaks FB We hope your weekend includes this! #Wildyfishing
May 20 Social Instagram I think this creek needs to be explored. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape
May 20 Social Instagram Getting in early session in before heading to the shop. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape
May 20 Social Wilderness Systems Kayaks FB You weren't born to just pay bills and die! Life's an adventure, LIVE IT. #WildernessSystemsKayaks
May 20 Social Instagram Follow your dreams!!! Last summer at Steamboat Rock State Park, Wa. #nature #followyourdreams #gofsr #kayaking #kayak #climbing #hiking #ipadventures #wildernesssystems #canon
May 20 Social Instagram First day out on the kayak this season #kayak #kayaking #fishing #wildernesssystems
May 20 Social Instagram First day out this season #kayak #kayaking #wildernesssystems #tarpon120 #fishing #kayakfishing
May 20 Social Instagram Summer is here and that means it's time to do some 'yakin! We got you covered for boat sales and rentals all summer long. Come see us and get out on the water! #kayakszn #jacksonkayak #wildernesssystems #perceptionkayaks #daggerkayaks #kayakfishing
May 20 Social Instagram Paddle pup...ready for adventure! • • • • • • • • • #adventurepups #adventurepup #adventures #adventure #explore #paddle #doggypaddle #kayaking #wildernesssystems #hobie #astraldesigns #blacklab #blacklabpuppy #labpuppy #labradorretriever #labsofinstagram #rescuedog #trainingday #staywild
May 20 Social Instagram When your in the mood for a little #slurpree @b3astridge @mi_fowl_play @mi_lip_rippers @smart_blade_works @rad_willie @alf_with_an_a #slurpee#hawgtrough #basstournament #kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan #mysterytacklebox #mysterytackleboxpro #katsmidwest #fishkats #hobiekayakfishing #hobieproangler14
May 20 Social Instagram If you need me, I'll be here...for as long as I possibly can. #kayaking #paddle #wildernesssystems #lake #centralcalifornia #serenity
May 20 Social Instagram #river #art . . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape
May 19 Social Instagram Not too bad tonight @nrsfishing @paddleva @lews_fishing @lowrancefishing @wildyfishing @wildernesssystems #kayaking #kayakinglife #kayakfishing #kayakbassfishing #lifeofadventure #lifeoutdoors #lifeoutside #kayakfishingfrenzy
May 19 Social Instagram . . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #tempest165 #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #kayaklyfe #kayakgram #paddlingmixtape
May 19 Social Instagram #tbt the original #adventurepup, Gryffin, showing the pups how it's done. • • • • • • • • • #adventure #adventures #adventurepups #kayaking #adventureswithdogs #wilderness #wildernesssystems #safetyfirst #rescuedog #rescue #rescuepups #waterdog #duckdog #explore #travel #nature #getoutside #optoutside #lakelife #doglife #paddle #doggypaddle #staywild #wild #lakelanier
May 19 Social Instagram Loved the leaning trees though this stretch. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #tempest165 #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #kayaklyfe #kayakgram #paddlingmixtape
May 19 Social Wilderness Systems Fishing Kayaks FB Please take our survery and win a $50 credit towards harmonygear.com! --->https://www.surveymonkey.com/r/TPRZ655 Help us make the best spray skirts on the market! Only applicable to paddlers who have experience with sit inside kayaks and those that have experience with spray skirts.
May 19 Social Instagram It looks like an eye was carved into the top of this rock ledge . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape
May 19 Social Instagram Adventurer in training #wildernesssystems #kayaking #kayak #yak #newengland #newhampshire #shelovedit #swimming #paddle #water #watersports #beactive
May 19 Social Instagram Quiet morning on the #tennesseeriver. An overcast day on the #river is better than any day at work! - - - - - - #optoutside #visitknoxville #betterthanwork #tennessee #betteroutside #ousideisfree #tennesseeoutdoors #refection #kayak #kayaking #bridges #wildernesssystems #samsunggalaxys7 #phonephotography #ig_nature #opticalillusion
May 19 Social Instagram Kayak/bag/camera set up. Simple backpack-cut the straps and sewed on clips. Added clips to deck. Much cheaper and works better. Bladder in bag means no more bottle rolling around. Modded a car/cell phone holder as a camera mound. Out wide to get less boat in the pic, but still easy to reach. Waterproof housing and quick release. This is a Polaroid cube. Every bit as good as GoPro, 1/4 the price... #kayak #kayaking #adventure #camping #mendocino #fortbragg #pointarena @wildernesssystems @wernerpaddles
May 19 Social Instagram Rollin'! Two Wilderness ATAK 140's following us to the YakAttack tournament. #wildyfishing #wernerpaddles #wildernesssystems #yakattack #becausewefish #paddle4fish #paddleva
May 18 Social Instagram What a gorgeous evening to be out on the water! #kayak #kayaking #wildernesssystems #blackcreek #newyork #visitvortex #optoutside #scenicny #newyorkexplored #explore #adventure #womenwhoexplore #herwanderfullife #goeast #nofilter #spring
May 18 Social Instagram Wilderness Systems Zephyr 155 y 160. Dos tamaños para acomodarse a kayakistas de distintos portes. Con un cockpit más grande, comodidad no falta en el Zephyr, es muy veloz, maniobrable, ágil y responde rápidamente cada movimiento que intentes. Wilderness está en nuestra página, elige el tuyo: www.riverslakesoceans.com #travesia #kayakdetravesia #seakayak #kayaking #patagoniachilena #patagonia #chile #argentina #rlo #riverslakesoceans
May 18 Social Instagram My Greenland paddle. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #tempest165 #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #kayaklyfe #kayakgram #paddlingmixtape
May 18 Social Wilderness Systems Kayaks FB Little video demonstrating just how stable Wilderness Systems Kayaks are!! 📷: Kevin Hofer
May 18 Social Instagram Guess we're a two boat family now. #kayak #paddling #ramakkos_sfa #kayaking #wildernesssystems #wildysystems #pungo140 #commander140 #hisandhers
May 18 Social Instagram Stumbled across this last night. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #tempest165 #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #kayaklyfe #kayakgram #paddlingmixtape
May 18 Social Wilderness Systems Fishing Kayaks FB The smile says it all! Who really cares how big the fish are as long as your are out fishing! :) #WildyFishing Photo by Josh Brightman
May 18 Social Instagram We have new Wilderness Systems kayak packages available in store! Get a free spray skirt and paddle with your purchase. #pnw #seattle #westseattle #kayak #kayaklife #explore #kayaking #kayaker #kayakingadventures #seakayaking #kayakexplorer
May 18 Videos Youtube Fly Fishing for Redfish and Sightcasting Redfish From a Kayak - Wilderness Systems Radar 135
May 18 Forums /r/Kayaking Fast sit-on-top for southern USA lake paddling: suggestions?
May 18 Social Instagram New boat day! Thank you Wild River Outfitters for a great deal on a great used kayak! #wildriveroutfittersvb #kayaking #newboatday #wildernesssystems #focus155
May 17 Social Instagram Her first time kayaking in ten years! #paddle #kayaking #kayak #yak #newengland #newhampshire #wildernesssystems #perception #water #watersports
May 17 Social Instagram Always a good time fishing with friends ... even if your @team13fishing rod and reels drops in #cayugalake ... #nykbf #fingerlakes #fuzzyguppies #kayakbassfishing #iloveny #teamfuzzyguppies #kayakfishing #fishNY ... and even if they paddle a #wildernesssystems ... lol #jacksonkayak #jacksonkayak4eva
May 17 Social Instagram Beautiful day on the water today. #kayakfishing #kayakbassfishing #tkaa #bassfishing #anglerapproved #rippinlips #largemouthbass #tugisthedrug #wildernesssystems #paddleva #vabeach #wernerpaddles #yaktribe #pigpatrol #catchandrelease
May 17 Social Instagram There was ice in this lake two days ago. Today? 70° and time to get the boat out. Summer is here! #rei #reiemployee #optoutside #coop #alaska #adventure #alaskalife #kayak #wildernesssystems #pungo #kokatat
May 17 News Rod Swan Surf Kayaks for wave riding and surfing - Custom made Mega Surf Kayaks
May 17 Social Instagram Boat control. #scullingbrace #lowbrace #wildernesssystems #kayak #kayaking
May 17 Social Instagram That feeling when it's still the work day but you know you'll be in a kayak on the water after work. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #tempest165 #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #kayaklyfe #kayakgram #paddlingmixtape
May 16 Social Instagram Kayaking Priest Lake!!! #godscountry #kayaking #kayakingadventures #kayak #pnw #ipadventures #inmanphotography #pnwonderland #pnwcollective #paddle #priestlake #mylife #wildernesssystems
May 16 Social Instagram Caught half dozen or more this size Saturday during the tournament. Only rememberd once to record video. New link in bio for a catch, measure release a #dink! @mi_lip_rippers @mi_fowl_play @b3astridge @flukemaster @kayakbassfishing #hawgtrough #katsmidwest #basstournament #kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan #mysterytacklebox #mysterytackleboxpro #katsmidwest #fishkats
May 16 Social Instagram New YouTube video in the making. DIY deck mat for the Radar135 #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #helixpd #diy
May 16 Forums NorCal Kayak Anglers I have two kayaks for sale Wilderness Systems The Ride and Cobra Fish N Game
May 16 Social Instagram Time for a trip to Sullivan Lake, Wa!!! Get out there!!! #wildernesssystems #mylife #paddle #kayak #kayaking #kayakingadventures #ipadventures #lakelife #lake #camping #pnw #pnwlife #pnwonderland #pnwcollective
May 16 Social Wilderness Systems Fishing Kayaks FB Little video demonstrating just how stable Wilderness Systems Kayaks are!! 📷: Kevin Hofer
May 16 Social Wilderness Systems Kayaks FB Sometimes all you need is a little water, a kayak and a sunset! Middle Concho River in San Angelo TX. #nofilter #WildernessSystemsKayaks #kayaking 📷: Kathy Walker
May 16 Social Instagram Had an awesome first time on Lake St. Clair yesterday with @clyde.ickes in the kayaks. Absolutely LOVE the performance of my new @wildernesssystems Ride 115, especially on the big water. Caught 7 different species too! Huge thanks to @jrscott26427 for all his advice and help! #wildernesssystems #kayakfishing #puremichigan #northernpike #smallmouth #smallie #largemouth #fishing #kayaking #stcroix #hukfishing #shimano #stclair #lakestclair
May 16 Social Instagram Bracing. #wildernesssystems #wildernesssystemskayaks #kayaking
May 16 Social Instagram Paddle paddle paddle #kayaking #yak #kayak #wildernesssystems #perception #newengland #newhampshire #goutside #livelife
May 16 Videos Youtube Kayak Fly Fishing in the Wilderness Systems Radar 135 Helix PD Marsh Trip Alligator Gar on Fly
May 15 Videos Youtube Sea Kayak Surf - Santa Clara, Buenos Aires, Argentina - 7BSK Seven Boys Sea Kayak
May 15 Social Wilderness Systems Fishing Kayaks FB Ever have one of those weekends you wish would never end? #Wildyfishing 📷: Jared Esley
May 15 Social Instagram Got her wired up and operational. @lowrancefishing makes some good electronics. This thing has been dropped, submerged and been in some of the worse weather mother nature has to throw at it and it keeps on ticking away. Great stuff to use. #kayakfishing #kayakbassfishing #kayaking #kayak #wildernesssystems #wildyfishing #atak140 #fishing #fishfinder #kayakrigging #lowrance
May 15 Social Instagram Although I didn't place, it was a good day of fishing, looking forward to the next tournament!#kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan @mi_lip_rippers @mi_fowl_play @b3astridge @flukemaster @kayakbassfishing #mysterytacklebox #mysterytackleboxpro #katsmidwest
May 15 Forums NorCal Kayak Anglers Re: Wilderness Systems Lithium Battery-new thread
May 15 Social Instagram Thanks @REI for helping to put in this kayak ramp to make it easier to get down to the water! ❤️ #dogslife #dogapproved #happylife #kayak #kayakingdog #kayakingwithdogs #lovemydog #enjoylife #lifeisgood #liveyourlife #lifeisbetterwithadog #adventuredog #adventureawaits #kayaking #pungo120 #wildernesssystems #beautifulday #optoutside #alifeoutdoorsisalifewelllived #forceofnature #unitedoutside #blueskies #puremichigan #adventure #lifeisbeautiful #lovethis #loveyourlife #authentic #stewardship #rei
May 15 Social Instagram Radar 135 with DIY deckmat. #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildy #wildernesssystems #helixpd #radar #radar135 @wildyfishing
May 15 Social Instagram Thank you @nextadventure for the @wildernesssystems A.T.A.K 140. I can't wait to get this beast on the water. #wildernesssystems #kayaking #kayakfishing #kayak #lake
May 14 Social Instagram Still working on it. Wilderness Systems Radar135 deck mat. #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #helixpd #wildernesssystems #radar #radar135
May 14 Social Instagram Got the fish finder installed in the removable pod for the kayak tonight. Just have to get a new battery and finish the inside. Made an adapter block for the bottom of the scupper bracket from the other boat since I didn't have the original bracket to install the transducer. Everything is nice and solid. @wildyfishing #kayakfishing #kayakbassfishing #kayaking #kayak #wildernesssystems #wildyfishing #atak140 #fishing #fishfinder #kayakrigging #lowrance
May 14 Social Instagram Very happy with this setup on my ATAK 140 Makes setting up to go fishing a lot better now. My last boat I needed a separate battery box to use. @wildyfishing #kayakfishing #kayakbassfishing #kayaking #kayak #wildernesssystems #wildyfishing #atak140 #fishing #fishfinder #kayakrigging #lowrance
May 14 Social Instagram Finished! #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #radar135 #radar #wildernesssystems #helixpd #wildy
May 14 Social Instagram Mothers comes in all shapes and sizes. Happy Mother's Day to all the great Women in my life. #mothersday #kayaking #paddleseason @boatingindc #keybridge #potomacriver @wildernesssystems #babygeese #rooseveltisland
May 14 Social Instagram We have a great time kayaking 16 miles on the Yadkin River today. We saw around 65 species of birds too. #winstonsalem #yadkinriver #birding #wildernesssystems #riteintherain #garmin #kayaking #swarovskioptik
May 14 Social Instagram So many awesome photos from last year surfacing! #bvdboatparade @bayouvermiliondistrict #wildernesssystems #reptheriver #lafayettestrong #acadiana #vermilionriver #kayaking #cannonpaddles #beachball #louisiana
May 14 Social Wilderness Systems Kayaks FB To all the awesome moms out there today is your day! HAPPY MOTHER'S DAY.
May 14 Social Instagram Enjoying a beautiful day on the water with my lady, @annelyomega . The wind is doing a not cooperating, but still a good time. #kayaking #creek #sundayfunday #spring #saltlife #optoutside #wildernesssystems #pungo120 #perceptionsport #swiftwater #homesweethome
May 14 Social Wilderness Systems Fishing Kayaks FB To all the amazing moms out there, HAPPY MOTHER'S DAY!
May 13 Social Instagram Whooooo wants a kayak??? Selling mine! Great condition! Wilderness Systems Pungo 120. Includes paddle and seat cover. $450 #vt #ilovermont #nature #beauty #kayaking #getoutside #summervibes #youknowyouwanna
May 13 Social Instagram #wildernesssystems #kayaking #foxriver #summerfun #letsgooutside
May 13 Social Instagram Part one of the deck mat project on the way. #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #radar135 #radar
May 13 Social Instagram We got new kayaks! Guess which one's mine! #kayaking #wildernesssystems #nofilter
May 13 Social Instagram #demo day #belleisle #paddlehappy #nativewatercraft #hurricanekayaks #wildernesssystems #wernerpaddles #northshore #valley
May 13 Social Instagram Ready to get out on the water! Grey clouds have all gone away @wildernesssystems @wildyfishing @lowrancefishing @lews_fishing @uglystik @paddleva @nrsfishing #kayakfishing #kayaktournament #kayakbassfishing #kayakfishingfrenzy #weather #bluesky #kayaking #kayakingtrip #kayakinglife #kayakingadventure
May 13 Social Wilderness Systems Fishing Kayaks FB We hope your weekend includes some of this! #Wildyfishing 📷: Scott Schrader
May 13 Social Instagram It's not a great day to go paddling, but it's a perfect day to gear up for your next trip. We have aisles of accessories to make your trip a bit easier. . . . . . . . #canoecountryfl #ccofl #wildernesssystems #harmony #stpete #tampabay #florida #kayak #kayaking #paddlefishing #kayakfishing #angler
May 13 Social Instagram Finally snuck in a paddle..., . . . . #floridakeys #islamorada #flyfishing #girlswhofish #kayakfishing #kayaking #wildernesssystems #tarpon100
May 13 Social Wilderness Systems Kayaks FB Wilderness Systems Kayaks are so comfortable you will have to fight your dog for it! :) #WildernessSystemsKayaks
May 13 Social Instagram Kevin got no White Bass bites at Lake Nacimiento but had some fun on the Wilderness Systems Thresher‼️° #lakenacimiento #lakeoroville #clearlake #kayaking #kayakfishing #funinthesun #wildernesssystems #nowakezone
May 13 Social Instagram That's a wrap for today's Demo Day! If you missed us today, be sure to check us out again on June 3rd! Same bat time, same bat channel.... #demoday #hobiefishing #kayakfishing #welovemidcity #nativewatercraft #jacksonkayak #wildernesssystems #perceptionkayaks
May 12 Social Instagram First time getting out and fishing in my new wilderness systems radar 135, few trout in the net. All and all a good night on the water. ##radar135 #flyfishingaddict #flyfishalberta #flyfishing #flyfishingalberta #kayak #kayakfishing #kayaking #wildernesssystemsradar135 #wildernesssystems @wildyfishing @wildernesssystems
May 12 Social Instagram Weekend project: deck mat the Radar 135! #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildy #wildernesssystems #radar #radar135
May 12 Social Instagram Nice skies tonight! I wish it was a little warmer though!#bassfishing #fishing #kayakfishing #kayakangler #kayaking #kayak #wildernesssystems #sunset #sunsets #sun #sky #skyporn #clouds #cloudporn #dusk #nature #thegreatoutdoors #picoftheday #pictureoftheday #photography #lake #lakelife
May 12 Forums /r/Kayaking Have a bunch of questions about buying my first kayak. Budget around $1k including the essentials. I'd appreciate any help!
May 12 Forums NorCal Kayak Anglers Re: Looking for ideas
May 12 Social Instagram Kayak is ready to rock for this weekend! Also check out my latest YouTube walk through on how I have it set up and rigged for tournament fishing! Link in bio! #kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan @mi_lip_rippers @mi_fowl_play @b3astridge @flukemaster @kayakbassfishing
May 11 Social Instagram This is a pretty great way to spend the evening when the fish aren't biting #kayaking #kayak #wildernesssystems #uneek #keenuneek #keen
May 11 Social Instagram Couple bass tonight, unfortunately I lost more than I caught! #bass #bassfishing #largemouthbass #largemouth #catchoftheday #catchandrelease #cantstopwontstop #kayakangler #kayakfishing #kayaking #lake #lakelife #freshwaterfishing #freshwater #fish #lifestyle #selfie #myaddiction #nature #thetugisthedrug #thegreatoutdoors #bassmaster #wildernesssystems #rippinlips #bentrods #fishinglife
May 11 Social Wilderness Systems Kayaks FB In the end we only regret the things we DIDN'T do! #WildernessSystemsKayaks
May 11 Social Wilderness Systems Fishing Kayaks FB I got 99 problems and fishing from my kayak solves them all!! #Wildyfishing
May 11 Social Instagram Open ocean kayaking, Golfo Dulce, Osa Península, Costa Rica #junglekayaking #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing
May 10 Social Instagram Awesome boat! Can't wait to get this boat out and yank some lips! @wildyfishing @wildernesssystems #wilderness #outdoors #wildernessculture #kayak #kayaking #greatoutdoors #kayakfishing #fishing
May 10 Social Instagram Went to get my #pungo and found a Carolina wren nest. One very mad mother and 2 chicks. #wildernesssystems #pungo100 #kayaking
May 10 Social Instagram My new toy ° #tarpon120 #wildernesssystems #kayaking #anglerlife #fishing
May 10 Social Wilderness Systems Fishing Kayaks FB Take the survey now and help us help you!! We are looking to make a unique line of dry bags that our fans will love! Please take a minute and take this quick survey by CLICKING HERE ---> https://www.surveymonkey.com/r/GYZ5HNJ
May 10 Social Instagram Absolutely gorgeous day for kayaking! ❤️ #dogslife #dogapproved #happylife #kayak #kayakingdog #kayakingwithdogs #lovemydog #enjoylife #lifeisgood #liveyourlife #lifeisbetterwithadog #adventuredog #adventureawaits #kayaking #pungo120 #wildernesssystems #beautifulday #optoutside #alifeoutdoorsisalifewelllived #forceofnature #unitedoutside #blueskies #puremichigan #adventure #lifeisbeautiful #lovethis #loveyourlife #authentic
May 10 Social Instagram Completely in my element spending hours today on #LakeGrapevine practicing and perfecting strokes with my new mentor for adventures coming my way! °❤️#spring2017 #wildernesssystems #outdoorwomen #definefeminine #wernerpaddles
May 9 Forums NorCal Kayak Anglers FNG Here
May 9 Social Instagram Family day... just me and mom dukes. #harpeth #oldtown #wildernesssystems #kayaking #hiphop #jamband #alllove #nevercouldbeanythingelse #erryweek #getoutside #icouldcry #sun #science #hashtag #selfie #myface #youknow #betterknowit
May 9 Social Instagram First trip of the summer #seakayaking #kayaking #glengarriff #glengarriffharbour #bantrybay #cork #ireland #instaireland #inspireland_ #irishpassion #wanderireland #summer #wildernesssystems #perceptionkayaks
May 9 Social Instagram This Saturday, join us on Bayou St. John for a free kayak demo! We'll be bringing out all your favorite models from brands like Hobie, Jackson Kayak, Native Watercraft, Wilderness Systems and Perception. 10am to 3pm, come try before you buy! #kayakdemo #demoday #hobiefishing #jacksonkayak #wildernesssystems #kayak #kayakfishing #welovemidcity #bayoustjohn
May 9 Social Instagram Looking for a tandem boat for your family? We have 3 for sale - Wilderness Systems Pamlico with rudder (x2) and Perception sit-on top Tribe. They are cleaned up and ready to go home with you! Message us or give us a call for pricing. #riverlife #kayaking #paddlefxbg #rappahannock
May 9 Social Wilderness Systems Kayaks FB Could use one every day!!
May 9 Social Instagram It was chilly, water was up and muddy but we still had a great time. Great way to spend your anniversary thanks to my awesome wife ° #kayaking #fishing #kayakfishing #wildernesssystems #ride115 #tarpon135t #ride115xmaxangler #shimano #shimanoreels #shimanosustain #gloomis #gloomisnrx #gloomisrods #gloomisfishing #virginia #virginiarivers #virginiafishing #newriver #pembroke
May 9 Social Instagram I couldn't ask for a better wife, loving and beautiful and takes me fishing and kayaking on our 18th anniversary. I love you @skylar2caleb Happy Anniversary °#bestwifeever #loveyou #18thanniversary #kayaking #kayakfishing #fishing #wildernesssystems #shimano #shimanoreels #shimanosustain #gloomis #gloomisnrx #gloomisrods #newriver #pembroke
May 9 Social Instagram So this was my parents first time in a kayak and I threw the right on the New River lol probably not the smartest move I ever made but they did great. #pembroke #newriver #virginiarivers #wildernesssystems #tarpon135t #kayakfishing #kayaking #shimano #shimanoreels #garyyamamoto #yamamotobaits
May 9 Social Wilderness Systems Fishing Kayaks FB Show us a pic of your fish!! #Wildyfishing
May 9 Social Instagram Kayaking with the Bugs! #doggles #harpethriver #kayaking #itsadogslife #rescuedog #rescuedogsofinstagram #wildernesssystems #puppymillrescue ##ventureready #cumberlandtransit #cumberlandtransitambassador #affenpinscher #flyfishingdog
May 8 Social Instagram Fresh batch ready for skirts. @mi_lip_rippers @mi_fowl_play @b3astridge @jleohuntfish @smart_blade_works #fishing #diyfishinglures #abugarciaforlife #13fishing #wildernesssystemskayaks #wildernesssystems #ride115 #puremichigan #kayaking #kayakbassin #kayakfishing #kayakbassfishingtournament
May 8 Social Instagram And then this happened #sunset #bluesky #skylover #skyporn #sundayfunday #iphone #summer #paddle #kayaking #yaklife #oklahoma @canthandletheploof #freshwater #wernerpaddles #wildernesssystems #perceptionkayaks
May 8 Social Instagram Didn't catch a single fish° however I do love this woman. #lowtide #kayaking #wildernesssystems #tarpon140 #cuda14
May 8 Social Instagram Our boat demo is this Wednesday! We'll be out at River Park North from 4p-7p with our demo fleet ready to get you on the water. This is the perfect opportunity to test paddle that kayak you've had your eye on! See link in bio for more details. #hobiekayak #wildernesssystems #jacksonkayak #hurricanekayak #nucanoe #feelfreekayak #boatdemo #kayak #canoe
May 8 Social Instagram #jetlife #lake #wildernesssystems #wernerpaddles #freshwater #lake #paddle #yaklife #sundayfunday #skylover #sunset #bluesky #orangesky #skyporn #iphone #nature @canthandletheploof #birdwatching
May 7 Social Instagram Dragged my daughter on the lake for a little bit. Just 1 bass a few pickerel. Tomm is another day! #bass #bassfishing #largemouth #largemouthbass #catchoftheday #catchandrelease #cantstopwontstop #lifestyle #myaddiction #kayakangler #kayakfishing #kayaking #kayak #lake #lakelife #pictureoftheday #selfie #fishon #rippinlips #wildernesssystems #baitcaster #lunkerchasers #spring #thetugisthedrug #thegreatoutdoors #nature
May 7 Social Instagram Want free fishing gear? ••• Click on the link in my bio and download the NPS (National Pro Staff) App. By using my link, you and I will both gain points that can be used to get FREE fishing gear. ••• #pickerel #bassfish #bass #summer #wildernesssystemkayaks #bassfishing #abugarcia #fishing #berkley #catchandrelease #wildernesssystems #largemouthbass #free #kayaklife #l4l #nature #angler #kayak #fresh #follow4follow #like4like #freshlife #freshwaterfishing #fishagram #edit #kayakadventures #kayaking #kayakangler
May 7 Social Instagram So what is Kayak Fishing Frenzy #kayakfishing #kayakbassfishing #kayak #wildernesssystems #jacksonkayak #oldtownkayak #kayakfishingfrenzy #kayaktournament #kayaktournamentangler @wildernesssystems @oldtowncanoes @jackson.kayak @advancedelements @hobiecatcompany
May 7 Videos Youtube REVIEW: Wilderness Systems Tsunami 140 Kayak
May 7 Forums /r/Kayaking Looking to upgrade to a fiberglass boat.. any suggestions?
May 7 Social Instagram A slow bite today as expected, but still landed 3 fish. #bass #bassfishing #largemouth #pike #largemouthbass #largemouthbassfishing #catchoftheday #catchandrelease #cantstopwontstop #lake #lakelife #kayakangler #kayakfishing #kayaking #kayak #wildernesssystems #thegreatoutdoors #thetugisthedrug #spring #selfie #picoftheday #pictureoftheday #nature
May 7 Social Instagram Newest addition to the fleet of toys. I can't wait to get some paddle time in. @wildernesssystems #pungo120 #pungo #kayak #kayaking #md #paddle #wildernesssystems
May 7 Social Instagram Had the seat on my @wildernesssystems kayak too far forward and popped it out of the groove. There was no way I was going I to the water though. #kayak #kayaking #oklahomariver #oops
May 7 Social Wilderness Systems Kayaks FB That's funny!!
May 7 Social Wilderness Systems Fishing Kayaks FB We hope your weekend included some of this! #Wildyfishing
May 6 Social Instagram Zman always clutch! This sealed it. . . . . #zman #wildernesssystems #kayakfishing #inshore #hckac #hckaclub #tournament #windy #hardcore #fish #snook #kayaking #yakangler #flogrown #procure #saltwaterexperience #flatsclass @zmanfishingproducts @wildyfishing
May 6 Social Instagram Bold women... Big hearts. Heroes on the Water event. #cumberlandtransitambassador #cumberlandtransit #ventureready #volunteering #womenpower #hook1outfitters #flyfishingwomen #womenempowerment #strongwomen #strongwoman #kayaking #wildernesssystems #friends
May 6 Social Wilderness Systems Fishing Kayaks FB Wilderness Systems Kayaks the most COMFORTABLE kayak you will ever own. They're so comfortable you will have to fight your dog for it! #Wildyfishing
May 6 Social Wilderness Systems Kayaks FB People LOVE the COMFORT and STABILITY of Wilderness Systems Kayaks but you know what else they love? All our very cool colors! Show us a pic of your Wilderness Systems Kayaks.
May 6 Social Instagram Wishing we were #yakin #wildernesssystems #delawarewatergap #coolersandbeer #nobearsonthewater #kayaking #fishing #saltlife #exceptnosalt
May 6 Social Instagram Kesän ensimmäinen #melonta #kesä #kajakki #joki #meri #silta #porvoo #visitporvoo #suomi #mahtipäivä #kaislikossasuhisee #sininentaivas. First #kayak #wildernesssystems #kayaking #trip this #summer #river #sea #bridge #sunshine #sun #greatfeeling #finland @suutarinenj
May 6 Social Instagram Taking these #badboys on the lake for the first time this year. #water will be #cold but let's plan on not tipping over. Loving this #gorgeous #weather!! #keepitup #mn! #kayaking #kayak #wildernesssystems #tarpon120 #madisonlake #keepitsimple #thule #aquabound #wernerpaddles #subaru #crosstrek #life
May 5 Videos Youtube Pre-Spawn Kayak Bass Fishing
May 5 Social Instagram Nothing like a great day out on the water. #wildernesssystems #reiyonkers #reiemployee #nofilter #ny #kayaking
May 5 Social Instagram @sydsewell7792 with an absolute toad out of her Yak! -----------------------------------------------------------DM me or #explorekayakfishing for a feature! #kayak #kayaking #kayakfishing #kayakbassfishing #largemouthbass #LMB #yakaddicts #jacksonkayak #wildernesssystems #hobie #fishing #freshwaterfishing #saltwaterfishing #catfishing #crappiefishing #creekfishing #creeklife #riverfishing #riverlife #like #follow
May 5 Social Instagram @carmenskayaks 239-333-7332 #novice #kayak #fisherman #fisherwoman #kayaking #kayakguidedtours #kayakfishingguide #kayakfishing #redfish #snook #sheepshead #jackcrevalle #fishinglessons #wildernesssystems #Penn #shimano #guidelife
May 4 Social Instagram Rainforest kayaking, Golfo Dulce, Osa Península, Costa Rica #junglekayaking #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing
May 4 Social Instagram Got a few new #wildernesssystems boats for our Bandon/Coos and Rogue Fleets. Oregon's south coast is holding massive paddling opportunities! #thepeoplescoast #traveloregon #SCT #kayaking
May 4 Social Instagram Working on plans for the weekend yet? Don't forget we have some of the best rental rates in town. No better way to enjoy the weekend than on the water! . . . . . . . #canoecountryfl #ccofl #rental #kayak #kayaking #paddlinf #weekend #florida #stpete #tampabay #fishingkayak #wildernesssystems #perceptionkayaks
May 4 Social Instagram A hoss of a catfish drug in buy @tommyblommy.. Pic sent in by @bashfab! ----------------------------------------- DM me or #explorekayakfishing for a feature! #kayak #kayakfishing #kayaking #yakattack #yakaddicts #jacksonkayak #wildernesssystems #fishing #bassfishing #catfishing #crappiefishing #outdoors #largemouthbass #LMB #creekfishing #creeklife #riverfishing #riverlife #freshwaterfishing #saltwaterfishing #savetheskinnywater #follow #like
May 4 Social Instagram We are one week away from the Triad Boat Demo! Come try out some boats you've been curious about next Thursday at Oak Hollow lake from 4pm-7pm. No reservations necessary, just show up. See you there! #boatdemo #hobiekayak #jacksonkayak #kayakfishing #wsnc #northcarolina #nctriad #wildernesssystems #perceptionkayaks #northcarolina #kayaking #oakhollow
May 4 Social Instagram This Saturday, May 6th - at the Vermilionville pond in Lafayette, try new models from Jackson, Wilderness Systems, Native Watercraft, NuCanoe, Bote Board and others. Come try the Wilderness Systems 'Radar' or the Jackson 'Mayfly' and experience the full line up of 2017 Hobie kayaks featuring the new Mirage Drive 180! #kayakdemoday #inspiringhorizons #hobiefishing #jacksonkayak #wildernesssystems #nativewatercraft
May 3 Videos Youtube Wilderness Systems Fishing Kayak Helix Pedal Drive First Impressions for Kayak Fishing
May 3 Social Instagram #exploregeorgia #northgatreks #salocoalake #kayak #kayaking #exploregordon #calhounga #lakelife #wildernessculture #wildernesssystems #tarpon100 #womenwhoexplore #thenomadstories #herwanderfullife #wandernorthga #discovering_captures #optoutsidegeorgia #optoutside #getoutsidegeorgia #getoutside #southernroamer
May 3 Social Instagram It's Coming! Mark Your Calendars now! This is one of the largest Paddlesports Demo Days and conveniently located in FarmVille, Virginia.#paddleva #kayakfishing #kayakbassfishing #wildernesssystems #hobiefishing #jacksonkayak #nativewatercraft
May 3 Social Instagram Don't you wish you could drop in at the #base of the #hooverdam #kayaking #blazinpaddlestour #blazinpaddles #kayaktours #kayaking #arizona #coloradoriver #nevada #lasvegas #offthestrip #willowbeach #emeraldcave #aquabound #wildernesssystems #gopro #iphone
May 3 Forums NorCal Kayak Anglers Re: Introducing the Wilderness Systems Radar 115 & 135 *see PDF files at bottom
May 3 Social Instagram Nice little bass I caught on some skinny water yesterday! ------------------------------------ DM me or #kayakcatches for a feature! #kayak #kayakfishing #kayakcatches #kayaking #yakattack #yakaddicts #jacksonkayak #wildernesssystems #fishing #bassfishing #outdoors #largemouthbass #LMB #creekfishing #creeklife #riverfishing #riverlife #freshwaterfishing #saltwaterfishing #savetheskinnywater #follow #like
May 3 Social Instagram #kayaking #kayakfishing #kayakadventure #selfie #yorktown #seaford #ocean #saltwater #saltlife #saltwaterfishing #wildernesssystems #onshore #shorething #beachlife
May 3 Social Instagram Lateral line sex appeal #wildernesssystems #wernerpaddles #shimanoreels #dobynsrods
May 3 Social Wilderness Systems Kayaks FB Go where most boats can't go! #WildernessSystemsKayaks
May 3 Social Wilderness Systems Fishing Kayaks FB Stable, comfortable and durable - Wilderness Systems Kayaks! #Wildyfishing
May 3 Social Instagram Nice bass I caught off the Coosa HD the other day! ----------------------------------------- DM me or #explorekayakfishing for a feature! #kayak #kayakfishing #kayaking #yakattack #yakaddicts #jacksonkayak #wildernesssystems #fishing #bassfishing #outdoors #largemouthbass #LMB #creekfishing #creeklife #riverfishing #riverlife #freshwaterfishing #saltwaterfishing #savetheskinnywater #follow #like
May 2 Social Instagram One of our customers took his new @wildernesssystems Radar 135 with Pedal Drive out for his first spin last weekend in Florida. Thanks for sharing Nic! This thing is a beauty. #kayakfishing #wernerpaddles #ctug #wildernesssystems #radar135 #helixpd #yakattack #floridafishing #destinfishing #humminbird #fishing #redfish #quiversports #quiver_sports
May 2 Social Instagram Breakfast with a view. I love my kayak. #Kayakfishing #kayaking #greatoutdoors #jetboil #wildernesssystems #frontierx #cameracase #hardcase
May 2 Social Instagram Bridge over the river Mon near Greensboro, PA. #monongahelariver #kayaking #wildernesssystems
May 2 Social Wilderness Systems Kayaks FB Who else loves to start their day like this? #WildernessSystemsKayaks
May 2 Social Instagram Weekends are for paddling lakes and exploring islands °°‍♀️°°°° #LakeLanier #LakeLanierIslands #PitbullsofInstagram #WildernessSystems #Kayaking
May 2 Social Instagram Monday Funday. Had the whole millpond to ourselves yesterday - #nc #kayaking #ncstateparks #paddling #kayak #optoutside #nc100miles #outdoors #merchantsmillpond #draintheswamp #nature #water #cypressswamp #cypresstrees #wildernesssystems #tarpon120 #yaklife
May 2 Videos Youtube Tarpon On A Tarpon (Wilderness Systems Tarpon 140)
May 2 Videos Youtube Derwent Water Kayak Tour
May 1 Forums NorCal Kayak Anglers Re: Ff battery pack
May 1 Social Instagram #camecuaro #michoacan #camecuaroenkayak #kayakmaniafishing #kayaks #kayakfishing #wildernesssystems #kayakanglers #yakfishing #kayaking #kayakadventures
May 1 Social Instagram #kayaking #Teifi #Teifigorge #Tarpon #wildernesssystems #tarpon140 #tarpon120 #westwales #wales
May 1 Forums /r/Kayaking Advice on kayak model
May 1 Social Wilderness Systems Fishing Kayaks FB That moment $30,000 is on the line and you put a big one in the net. #wildyfishing #KBF #NationalChampionship Craig Dye Photo: Mike Ernst
May 1 Social Wilderness Systems Kayaks FB You know what people love about Wilderness Systems Kayaks? They love how comfortable they are!
Apr 30 Social Instagram I wanted to upgrade my old jet ski trailer to a kayak trailer for years. The old wooden bunks worked, but I'm very happy with the Malone Crossbar Kit. I had to get a little creative and swap out a pair of u-bolts, but it was an easy conversion. #kayak #trailer #malone #crossbars #fishing #kayaking #wildernesssystems #wildyfishing #ack
Apr 30 Social Instagram Today we are putting the sport in #sportwagon! Enjoying #spring #kayaking on the #toccoariver - - - - - #unitedoutside #optoutside #vwlife #vwlove #vwfamily #4motion #mk7 #wagon #vw #6speedmanual #kayak #tarpon120 #paddling #georgiaoutdoors #wandergeorgia #outsideisfree #adventure #peacefulfloat #wildernesssystems #perfectweather #justgoshoot #samsunggalaxys7
Apr 30 Social Wilderness Systems Fishing Kayaks FB Tag your friend who would tell you he caught a lunker! :)
Apr 30 Social Instagram 13km recreational #kayak trip New Kahovka(Dnipro river) / Ukraine #kayakingkherson #vplavni #Dagger #alchemy #wildernesssystems #zehyr #wernerpaddles
Apr 29 Social Instagram So relaxing!!! °#kayaking #lake #adventure #relaxing #beautifulday #hot #sunny #wildernesssystems #husband #love #fun #instagram #jrphotoobsession #fishing
Apr 29 Social Instagram Kayaking adventure this Friday afternoon. #kayaking #adventure #lake #fishing #outdoors #wildernesssystems #nature #fun #beautifulday #hot #goproquik #love #instagram #jrphotoobsession
Apr 29 Social Standup Journal FB Demo day alert! Check out the annual Kayak and SUP Demo. Reps on hand from Native, Hurricane, Wilderness Systems, Hobie, BIC SUP, Exocet and Progressive Boards. Reps and staff on hand to assist with demo and answer questions: http://standupjournal.com/paddleboard-events/sandy-point-progressive-sports-kayak-sup-demo/
Apr 29 Social Instagram @pherro @gill_far #iphone #perceptionkayaks #wildernesssystems #wernerpaddles #kayaking #yaklife #paddle #spring #nature #getoutstayout #bluesky #outsideisfree #wander
Apr 29 Social Instagram #kayaking #WildernessSystems #Fishing
Apr 29 Social Instagram Big #sale today down at #westerncanoekayak come down and see what all the hype is about. And maybe bring home a #wildernesssystems #kayak #clippercanoe #jacksonkayak #hobiekayak or a #starboard #paddleboard
Apr 29 Social Instagram 2 hogs from today. Other bass@have been caught but these are the best so far. The day is not over!#fishing #bassfishing #largemouth #largemouthbass #largemouthbassfishing #lifestyle #myaddiction #lakelife #lake #catchoftheday #catchandrelease #cantstopwontstop #nature #picoftheday #pictureoftheday #thetugisthedrug #thegreatoutdoors #kayakangler #kayakfishing #kayaking #wildernesssystems #rippinlips #bassmaster #senco #chatterbait #selfie
Apr 29 Social Instagram Derelict railroad bridge over the Mon. #kayaking #monongahelariver #wildwonderful #wildernesssystems #prickettsfort
Apr 29 Social Wilderness Systems Kayaks FB Good thing they were Wilderness Systems Kayaks! The toughest most durable kayaks. #WildernessSystemsKayaks
Apr 29 Social Wilderness Systems Fishing Kayaks FB Go where other boats can't go this weekend! #Wildyfishing
Apr 29 Social Instagram We have a beautiful weekend before us ... What's your plan of #ATAK?? GetPaddling! Resource Page at link in profile. PC: @otislinkous #gopcstaff #weekendready #gopcgreensboro #gso #greensboro #traid #nc #northcarolina #kayak #kayaking #kayakfishing #kayakfishingnc #wildernesssystems #onthewater #getpaddling #weekendgoals #lifeoutside
Apr 29 Social Instagram A cloudy sunset. #kayak #kayaking #kayaklife #explore #explorenb #newbrunswick #canada #wildernesssystems #paddle
Apr 29 Social Instagram Kayak selfie. With bonus dog. #kayaking #paddling #boating #rhodeisland #perception #wildernesssystems #perceptionkayaks #wildernessystemskayaks #dogsofinstgram #puppiesofinstagram #dog #puppy #rescuedog #adoptdontshop #dachshund #jackrussell #beagle
Apr 29 Social Instagram 'Open your door and go explore.' - Aimless Adventures #ExploreMore #AdventureOn #kayaking #outdoorlife #wanderlust #dontfencemein mein #wildernesssystems #tarpon120 #livelifeoutloud #getoutthere #getoutdoors #outdooradventures #riverlife #saltlife #wildernesssystemskayaks #wildernesskayaks #yakattack #kayakcamping
Apr 29 Social Instagram Ahhhh....#relaxing #kayak #kayaking #kayakingadventures #kayaktrip #tampa #tampabay #wildernesssystems #wildernesssystemskayaks #tarpon160 #canoecountry @canoecountryfl
Apr 28 Social Instagram Newest addition to the Angry Anvil Plastic Fleet. Been wanting one of these since they came out. My Wilderness Systems ATAK 140 loaded up and ready to go. big thanks to my buddy @saltyhamm for selling it to me. With a good stop at @paddleva in Hampton for some extra gear to get me going. Thanks for the help, always great to go there. #kayakfishing #kayakbassfishing #kayak #watersports #itswhatido #lovetheoutdoors #outdoors #water #kayaking
Apr 28 Social Instagram The #hooverdam was releasing #water today . Made for an #easy and #beautiful #paddle down the #river for #blazinpaddles #fulldaytour #beautifulweather #aquabound #gopro #iphone #offthestrip #wildernesssystems #kayaking #kayaktours #kayak #hotsprings #arizonahotspring #goldstrikecanyon #arizona #lakemeadnationalrecreationarea #lakemead #willowbeach #emeraldcave #exhausted
Apr 28 Social Instagram !!!!!!!LINK IS IN BIO!!!!!Hey guys I just uploaded the full video on YouTube. Go check it out and let me know what you think!!!!! . . . . . . . . #alwaysactive #bowhunting #fishing #kayaking #carp #redneck #swamp #conoe #active #wildernesssystems #pacifcnorthwest #kayaking #fish #hunting #survival #tactical #bushcraft #pacifcnorthwest #pnw #washington #outdoors #upperleftcorner #usa #murica #boats
Apr 28 Social Instagram Couple bass caught but here's my best of the night. #bass #bassfishing #lmb #largemouth #largemouthbass #largemouthbassfishing #bucketmouth #catchandrelease #catchoftheday #picoftheday #pictureoftheday #kayakangler #kayakfishing #kayaking #spring #nature #thetugisthedrug #thegreatoutdoors #fish #lifestyle #myaddiction #bassmaster #wildernesssystems #rippinlips #bentrods #fishon
Apr 28 Social Instagram It's a wrap!! Rincón, Golfo Dulce, Osa Península, Costa Rica #junglekayaking #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing
Apr 28 Social Instagram Dam! This place was nice ° Dan did not enjoy himself one bit. #kayaking #kayak #yak #perception #wildernesssystems #newhampshire #paddling #water #dam #nature #funcouplestuff #kayaklife #kayakadventures
Apr 28 Social Instagram Spontaneous afternoon kayak trip. #kayak #kayaking #yak #perception #wildernesssystems #paddle #water #kayaklife #kayakadventures #forced #dilf #funcouplestuff
Apr 28 Social Instagram Beast! #beast#pike #pikefishing #bass #bassfishing #beastmode #rippinlips #bentrods #fishing #fish #wildernesssystems #nature #spring #catchoftheday #catchandrelease #picoftheday #pictureoftheday #freshwater #freshwaterfishing #thetugisthedrug #thegreatoutdoors #kayakangler #kayakfishing #kayaking #kayak#lake #lakelife #lifestyle #myaddiction
Apr 28 Social Instagram Feels like summertime, and the livin' is easy // 4.28.17 #florida #naturecoast #kayaking #gulfcoast #wildernesssystems #cleanwater #river
Apr 28 Social Instagram Flashback to Folly #follybeach #kayaking #kayak #wildernesssystems #ocean #beach #boat #boats #birdsofinstagram #birds #seagull #southcarolina #adventure #wanderlust #photographer #photography #vscocam #vsco #instagood
Apr 28 Social Wilderness Systems Fishing Kayaks FB 'I don't think it's love..it's an addiction' #atpaddles #wildyfishing
Apr 28 Social Wilderness Systems Kayaks FB The kayak fishing addiction. What you paddle makes all the difference.
Apr 28 Social Instagram Friday's Finds are Back! 1) Wilderness Systems ATAK 120 rudder install w/ Chase Tanner 2) Free Fall Visuals in the Sierras. 3) Josh Dolin, of Jackson Kayak, and Grant Alvis, of Hobie Fishing, chasing big blues in RVA. 4) Bobby Rae Allen and Big Briery Creek Lake bass. 5) The Free Fall Visuals crew puts together an excellent short on Patagonia. 6) And Rob Choi brings the Ruckus! Click the link in our profile for the goods! #paddleva #kayakfishing #RVA #whitewaterkayaking #wildyfishing #lynchburgva #richmond
Apr 28 Social Instagram She cleaned up good but found a passenger that didn't make it. Rain got it last night. Poor little lizard. #kayakfishing #kayakbassfishing #kayak #watersports #itswhatido #lovetheoutdoors #outdoors #water #kayaking #wildyfishing #wildernesssystems
Apr 27 Social Instagram When was the last time you did something for the first time? Yesterday I tried bow fishing,and I think I'm hooked. . . . . . . . . . #alwaysactive #fishing #bowfishing #hunting #archery #kayaking #swamp #hunt #wildernesssystems #trophy126 #washington #pnw #pacifcnorthwest #relax #active #outdoors #survive #redneck #bushcraft #bowhunting
Apr 27 Social Instagram Ontario Mill Pond on the Pigeon River in Howe, IN. #iphonephotography #kayaking #wildernesssystems #water #outdoors #dam #kayak
Apr 27 Social Wilderness Systems Fishing Kayaks FB Can your kayak do that? Wilderness Systems Kayaks, the most STABLE AND COMFORTABLE kayaks you can buy! #WildyFishing #ATAK
Apr 27 Social Wilderness Systems Kayaks FB 'One way to get the most out of life is to look upon it as an adventure.' #WildernessSystemsKayaks
Apr 27 Social Instagram Lake Keowee in South Carolina. The upcountry in South Carolina has some beautiful mountain lakes. The best views are from a kayak in the middle of the water ° #lakekeowee #keoweetoxawaystatepark #southcarolina #kayaking #paddling #lake #mountainlake #mountains #appalachianmountains #outside #getoutside #outdoors #thegreatoutdoors #travel #wander #traveler #wanderer #travels #trip #traveling #travelgram #wanderlust #gopro @wildernesssystems
Apr 27 Social Instagram Here's a favorite from when #TheLodge guys took a long weekend in the St. Regis Canoe area. Stay tuned for some shots from our next trip in June. #throwback #tbt #ADK #kayaking #wildernesssystems #pungo120
Apr 27 Social Instagram Got a couple lunkers this afternoon #fishing #fisheveryday #kayaking #kayak #kayakfishing #puremichigan #lunker #lunkers #lunkerchasers #lmb #largemouthbass #largemouth #bass #bassfishing #bassproshop #wildernesssystems
Apr 27 Social Instagram Dog approved! Day off, beautiful sun came out in the afternoon so we hit the water! #liveyourlife #lifeisgood #lovelife #selfcare #adventuredog #adventureawaits #alifeoutdoorsisalifewelllived #authentic #dogapproved #dogofinstagram #dog #kayak #kayaking #kayakingdog #puremichigan #kayakingwithdogs #wildernesssystems #beautifulday #sunnyday #suncameout #happydog #happylife #happyclouds
Apr 26 Social Instagram Beautiful #alabamasunsets #kayaking #kayakfishing #bassfishing #itsinmynature #wildernesssystems #perceptionkayaks #wherethemountainsmeetthelake
Apr 26 Social Instagram Medina lake w/ @vertical7crawlers #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy
Apr 26 Social Instagram Mogos, Golfo Dulce, Osa Península, Costa Rica #junglekayaking #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing
Apr 26 Social Instagram Last night we prepped for today's #waterwednesday Brandon had to float his new boat while little K practiced her paddling. What better way to spend some good Daddy daughter time. #kayaking #kayaks #wildernesssystems #daggerkayaks #familytime #outdoorfamily #optoutdoors #optoutside #beoutside
Apr 26 Social Instagram My new kayak Atak 140...this bad boy is really gonna get me on some fish quick. #kayaking #kayak #atak #wildernesssystems #fishing° #bassfishing #tightlines #kayakbassfishing
Apr 26 Social Instagram Being a Christian makes me a better adventurer.I know that many people think that once you gave your life to Jesus you become boring and don't do anything fun.Honestly I question those peoples faith but that's a different topic....every bible character in the Bible that committed their life to Jesus lived an epic life. Pual?man that dude was gnarly.He was a crazy backpacker that would hike across desserts to preach,Moses,crazy dude right there...first off, at age 120 he was strong as a young man,also he would go to the mountains for months to find the connection with God. King David?Uhm HELLO!!!!My hero right there. Don't even have to explain how he was a crazy mofo!!!! Say ya life of a Christian should be an epic adventure.Of course everything has to have a balance,there's time to go to church and adventure shouldn't interfere with that.Theres time for work/school/family,all that has a place but sitting around doing nothing, ya Christians shouldn't have time for that. °✍️°✍️°✍️°✍️°✍️° Seriously comment below any bible character that committed his life to Jesus and didn't have an epic life... I can't think of a single person so if you can ,let me know down below cuz I'm curios. Monday,Tuesday,Wednesday,Thursday,Friday,saterday,Sunday What do you know?we don't have 'someday'so if u wanna do great things,do it TODAY because someday will never come . . . . . . . . . #alwaysactive #outdoors #cali #roadtrip #surfing #kayaking #oceankayaking #pictureoftheday #pacificnorthwest #picoftheday #gopro #extreme #sandiago #califor nia #westcoast #adventure #active #relax #fishing #conoe #wildernesssystems
Apr 26 Social Wilderness Systems Kayaks FB You know why so many people tell us they LOVE Wilderness Systems Kayaks? They are the most maneuverable kayak they have ever owned! #WildernessSystemsKayaks 📷: @padleketil
Apr 26 Social Instagram The rains are here, and we all know that that means... IT'S PADDLING SEASON!! • Drop by @packratoc today and get outfitted for your next float. • #paddling #floating #kayaking #canoeing #river #creek #whitewater #waterfall #buffaloriver #mulberryriver #richlandcreek #kingsriver #packratoc #fayetteville #arkansas #nrs #astral #liquidlogic #perception #wenonah #madriver #wildernesssystems #dagger
Apr 26 Social Wilderness Systems Fishing Kayaks FB Want to catch more fish? Go where boats can't go! Get the safest and most comfortable kayak on the market - Wilderness Systems Kayaks. #Wildyfishing 📷: Pro Staffer Matt Eikenberg
Apr 26 Social Wilderness Systems Fishing Kayaks FB Wilderness Systems pro staffer Kris Cortez on spearfishing from a kayak! http://www.wildernesssystems.com/us/experience/team-blog/297/post/spearfishing-kayak
Apr 26 Videos Youtube [Best Seller] Wilderness Systems Aspire 105 Kayak Sonar One Size
Apr 25 Social Instagram In rush to escape. Few minutes later 20m/s wind gusts covered the area. #wildernesssystems #wernerpaddles #kayakingkherson #kayak #vplavni
Apr 25 Social Instagram Short stop prior to paddling in heavy winds. Chaika river Kherson region / Ukraine #wildernesssystems #kayak #vplavni #wernerpaddles #kayakingkherson #gopro
Apr 25 Social Instagram We were featured in a local thingy, what a good picture of us! @tiffanythib #vermilionriver #reptheriver #louisiana #kayaking #wildernesssystems #nativewatercraft #paddle #river #kayak #goodtimes #boatparade #bayouvermilion #bvdboatparade #thethib #bendingbranches #yaklife
Apr 25 Social Instagram #ExploreMore #kayaking #liveyouradventure #GetOutThere #AdventureOn #exploreyourworld #liveyouradventure #adventureisoutthere #kayaklife #riverlife #saltlife #yaklife #tarpon120 #WildernessSystems
Apr 25 Social Instagram Near Rincon River, Golfo Dulce, Osa Península, Costa Rica #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing
Apr 25 Social Instagram Dnipro river crossing in heavy winds. #kayakingkherson #vplavni #wernerpaddles #wildernesssystems #kayak
Apr 24 Social Instagram 04-23-17: Paddling Lake Moultrie's Santee Canal in Berkeley County SC. This paddle had a variety of ecosystems, beautiful scenery, calm, quiet paddle and wildlife that included alligators, herons and eagles #blazethattrail #paddling #paddle #kayak #kayaking #paddletrail #blueway #watertrail #water #lake #lakemoultrie #wildernesssystems #photography #wildlife #berkeley #berkeleycounty #canoe #canoeing #onlyinsouthcarolina #wanderlust #southcarolina #lowcountry #tourism #nikon
Apr 24 Social Wilderness Systems Kayaks FB So so not ready for Monday! #WildernessSystemsKayaks
Apr 24 Social Instagram Nothing super special today, however, I've now been on the water more times than I've been in the last two years combined. It's only April! Also, I love when the trees are budding. That bright green haze over the skeleton of the tree. Love spring! . . . . . . . #explore #explorewisconsin #TravelWI #chainolakes #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife #kayakgram_feature #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking #campistco #thediscoverer
Apr 24 Social Wilderness Systems Kayaks FB Nothing better than padding into the sunset! #WildernessSystemsKayaks
Apr 24 Social Wilderness Systems Fishing Kayaks FB Is your kayak this stable? #WildernessSystemsKayaks Wilderness Systems Pro Staff Eugene Mora shows off just how stable the ATAK can be.
Apr 24 Videos Youtube [Best Seller] Wilderness Systems Ride 135 Kayak - Low Outfitting Mango (Orange/Yellow Blend)
Apr 23 Social Instagram Ready for some paddling #kayaking #edmontonwhitewaterpaddlers #wildernesssystems #tempist
Apr 23 Social Instagram Just another day in paradise, Golfo Dulce, Osa Península, Costa Rica #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing #stonemountainoutdoors
Apr 23 Social Instagram Paddling happiness via @barrywalstead Taken from the #amazing @wildernesssystems #radar135 with the new #helixpd #pedaldrive
Apr 23 Social Instagram Calm waters and a blanket of snow. #kayak #kayaking #kayaklife #yaklife #wildernesssystems #paddle #spring #adventure #explore #explorenb #newbrunswick #canada #saintjohnriver #sunday #sundayfunday #followme #travel #instagood #picoftheday #peaceful
Apr 23 Videos Youtube [Best Seller] Wilderness Systems Tarpon 100 Kayak, Factory Seconda� Red One Size
Apr 23 Social Wilderness Systems Fishing Kayaks FB Who else isn't ready for Monday? #WIldyFishing 📷: Cory Dreyer
Apr 23 Social Instagram It was nice at first but got rough fast.. nothin but Spanish Mackerel.. @peachestlh #kayaking #kayakfishing #wildernesssystems #pelagic #offshore #perdidokey #pensacola
Apr 23 Social Instagram Just another day in paradise, Golfo Dulce, Osa Península, Costa Rica #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing
Apr 23 Social Instagram #litchfieldpark #kayaking #pungo120 #wildernesssystems #nobarkingdogshere
Apr 23 Social Instagram We see some cool boats come through our repair center at the shop. This one came in for a bit of touch up. We discovered it was a custom build by Wilderness Systems from the 90s, all Kevlar. . . . . . . . . . #canoecountryfl #ccofl #custom #kevlar #seakayak #wildernesssystems #kayaking #paddling #stpete #florida #tampabay
Apr 23 Social Instagram Our Annual Kayak/SUP Demo is next weekend! Saturday April 29th, from 8am-1pm. Our event will be held at the Port Orange Causeway by the North-West dock. There will be a very large selection of kayaks and paddle boards to try out. Let us help find the right kayak or board for you. Go check out our Facebook event and set the date! ➡️➡️https://www.facebook.com/events/145989779256619/?ti=icl⬅️⬅️ #kayaking #sup #demo #outdoors #water #Florida #hobie #wildernesssystems #jacksonkayak #surftech #exocet #progressive #bicsup
Apr 22 Social Instagram Her first adventure with me will be tomorrow . Let's hope she treats me like the as well as my Cuda14 #kayakfishing #kayaking #wildernesssystems#tarpon140 #saltwaterfishing #wernerpaddles
Apr 22 Videos Youtube WILDERNESS SYSTEMS Tarpon 100 Kayak, Factory SecondA� Red One Size
Apr 22 Social Instagram Heading out in the morning with the whole family for our first paddle all together. #kayaking #kayak #kayakgram #family #perceptionkayaks #oldtownkayak #wildernesssystems #hondaridgeline #southernliving #southerncharm #paddlefaster #getoutside
Apr 22 Forums /r/kayakfishing Kayak crate solutions
Apr 22 Videos Youtube Wilderness Systems Thresher 140 Kayak With Rudder Mango Orange One Size
Apr 22 Social Instagram Paddling happiness! Taken from the #amazing @wildernesssystems #radar135 with the new #helixpd #pedaldrive #paddlingmixtape #kayak #kayaking #seakayak #paddling #pugetsound #theafoss #sunshine @eddylinekayaks @sealsskirts @shiptoshoremarine @wildyfishing
Apr 22 Social Instagram Summer is coming!! . . . . . #vashonvintagebeachhouse #cabinlife #cabin #beach #beachhouse #pugetsound #mtrainier #airbnb #vrbo #tripadvisor #beachhousedecor #mycovetedhome #weekendgetaway #vashonisland #vashon #pnw #pacificnorthwest #pnwexplorations #pnwlife #pnwonderland #upperleftusa #island #coastalliving #cabinporn #kayaking #vashonlife #paddle #wildernesssystems
Apr 22 Social Instagram Kayaking in 50 degree rain, earned us some warm up time by the fire. #vapingsavedmylife #wildernessmen #wildernessculture #kayaking #kayakcamping #weekend #weekendvibes #wildernesssystems #family #fire #fireplace
Apr 22 Social Instagram YouTube review for the Helix PD in the works. Subscribe to my channel, link in bio. °° #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #helixpedaldrive #radar #radar135 #yaklyfe
Apr 22 Social Instagram Radar 135 w/ Ram Tubes #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #rammounts
Apr 22 Social Instagram Good day of fishing today. 9 bass total #fishing #bassfishing #largemouth #largemouthbass #largemouthbassfishing #catchoftheday #catchandrelease #cantstopwontstop #lifestyle #nature #thetugisthedrug #thegreatoutdoors #selfie #fish #freshwater #freshwaterfishing #rippinlips #bentrods #myaddiction #picoftheday #pictureoftheday #spring #springfishing #kayakfishing #kayakangler #kayaking #kayak #wildernesssystems #ilovefishing
Apr 22 Social Instagram Hooked up #kayaking #tarpon140 #wildernesssystems #redfish
Apr 22 Social Instagram I think our first date went well °#tarpon140 #wildernesssystems #limit #kayakfishing #shimano #pfg #chickenboylures #kayaking #texascoast #marsh
Apr 22 Social Instagram #virginiabeach #dobynsrods #wildernesssystems #wernerpaddles
Apr 22 Social Instagram Jake caught an award winning pickerel. #fishing #kayaking #wilderness #wildernesssystems #lake #freshwater #catchandrelease #pickerel #nature #outdoors #happyearthday #earthday2017 #instagram #jrphotoobsession
Apr 22 Social Instagram Our flag sticking out of the water. #kayak #kayaking #kayaklife #yaklife #wildernesssystems #explore #explorenb #adventure #gooutside #paddle #canada150 #activeon
Apr 22 Social Instagram Radar 135 with the Helix PD. Sexy... #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #starwars #r2d2
Apr 22 Videos Youtube [Best Seller] Wilderness Systems Aspire 105 Kayak Mango Orange One Size
Apr 22 Social Instagram Just breaking her in !! #tarpon140 #wildernesssystems #kayaking #saltwaterfishing #wernerpaddles #columbia #redfish #shimano
Apr 22 Social Instagram Early rise on Lake Carroll ° #carrollton #georgia #saturday #morning #sunrise #kayak #kayaking #paddling #lake #getoutside #outdoors #optoutside #active #recovery #lifestyle #wildernesssystems #gopro
Apr 22 Social Wilderness Systems Fishing Kayaks FB Can your kayak do that? #WidernessSystemsKayaks the most STABLE kayaks available! #Wildyfishing
Apr 22 Social Instagram 04-22-17: Loaded up and ready for tomorrow's mystery adventure and photo shoot. It's​ officially for work (wink) ...more information and awesome pics coming soon ° #blazethattrail #coolestcompanies #paddling #paddle #paddletrail #kayak #kayaking #blueway #watertrail #water #oceankayak #lowcountry #wildernesssystems #adventure #wanderlust #yakimaracks
Apr 22 Social Instagram Happy Earthday! Great day to be outside...#enoughpollenalready . . #adventure #adventuretramps #shootthehooch #kayaking #happyearthday #wildernesssystems #tarpon120 #sunburn #advlife #getoutstayout #carlislepaddles
Apr 21 Social Wilderness Systems Kayaks FB When purchasing a kayak, everyone has different things that are important to them. What is most important to you when buying a kayak? #WildernessSystemsKayaks
Apr 21 Social Instagram No pushing and shoving for campsites out here. You got the whole #island to yourself! #beachcamping #kayaking #wildernesssystems #noreservations #exuma #explorethebahamas #kayakgram credit: Diane C.
Apr 21 Social Instagram Doing a review on the Helix PD. #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildy #wildernesssystems
Apr 21 Social Instagram Off to the races. #kayaking #wildernesssystems #tarpon #paddlefaster #beavercreek #lakewateree #bassethound #prettyboy that's the dog's name.
Apr 20 Social Instagram Took my new #perception Kayak for a test run last night and so far I'm very happy with my purchase. It is stable, tracks well and has a very comfortable seat. After using my Wilderness Systems Pungo for 15 years I decided it was time to upgrade. I again went with another trusted brand which is manufactured by the same company as my first. I expect many years of use with this one as well. The ladyfish bite was great last night and also had a young curios Manatee hang out with me for a bit. #kayak #kayaking #kayakfishing #perceptionkayaks #sunset #florida #floridagulfcoast #hernandobeach #thisishernando #fladventurecoast #confluenceoutdoors
Apr 20 Social Wilderness Systems Kayaks FB Who's ready for the weekend? Whatever you have planned, we hope it includes some time spent in your Wilderness Fishing Kayaks!!
Apr 20 Social Instagram Relaxing my brain ° #seakayaking #seakayak #kayaking #kajak #kayak #capetownmag #lovecapetown #capetown @sawyeroars #kayakingislove @wildernesssystems @pelicanprofessional @lovecapetown @capetownlately @capetownmag
Apr 20 Social Instagram We paddled 2.6 miles through small craft warnings to get to Bear Island...and the same back. Who needs a gym? #wildernesssystems #kayaking
Apr 20 Social Instagram A video just for @porschlund . And I now realise your surname is NOT what I said. Apologies. The handle confused me and I had a terrible day so my brain was fried and I need this paddle. With some red wine and a pasta dish I have almost completed combined with the paddle life is good again. I also jinxed myself and within minutes a small wind picked up, shortly thereafter to maybe 15 knots and then dropped to maybe 5 on the way home. Great evening °✌ #seakayaking #seakayak #kayaking #kajak #kayak #capetownmag #lovecapetown #capetown @sawyeroars #kayakingislove @wildernesssystems
Apr 20 Social Wilderness Systems Fishing Kayaks FB Is there any better feeling than a sunrise on the water? #WildyFishing
Apr 20 Social Wilderness Systems Fishing Kayaks FB Good day for the Wildy fishing pro staff at the YakAddicts Three Rivers Throwdown tourney in GA last weekend. Shane Williams won Big Bass with a monster shoal bass, Reggie Diaz caught his personal best large mouth, and Brad Case took home first place. Congrats boys! #wildyfishing #yakaddicts
Apr 20 Social Instagram When your trying to snap out of a snag and then all of a sudden the snag starts fighting back @wildernesssystems @wildyfishing #tarpon120 #wildernesssystems #kayak #kayak_fish #kayakangler #kayaking #kayakfishing #sea° #sea #seafish #seafishing #seafishinguk #fish° #fishing #fisherman #fish #angler
Apr 20 Social Instagram Not the biggest but lovely coloured markings @wildernesssystems @wildyfishing @fredheath #sea #sea° #seafishing #seafishinguk #seafish #fishing #fish° #fisherman #flatfish #plaice #kayakfishing #kayaking #kayak #kayakangler #kayak_fish #kayak #wildernesssystems #tarpon120
Apr 19 Social Instagram Definitely not a big one but, First fish in the new yak! #bassfishing #largemouthbass #fishing #kayaking #kayakbassfishing #kayakfishing #wildernesssystems #ride135 #natescustombaits #ardentreels #rulethewater #teamardent #lakeforktrophylures
Apr 19 Social Instagram Up Rio Tigre, Golfo Dulce, Osa Península, Costa Rica #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing
Apr 19 Social Instagram Boats, bros and beers! Feeling grateful for a glorious sunny kayak adventure today. Even more special when open water season is still 1 month+ away at home! #summeriscoming #kayaking #urbanpaddling #getoutside #wildernesssystems
Apr 19 Social Instagram A full load down at the base of the #hooverdam . Can't get a better #viewpoint of that! #nevada #arizona #coloradoriver #kayaking #kayak #blazinpaddles #emeraldcave #willowbeach #wildernesssystems #offthestrip #lasvegas #mercedes #aquabound #gopro #iphone
Apr 19 Social Instagram Morning fog. #kayak #kayaking #kayaklife #yaklife #wildernesssystems #fog #river #explorenb #explore #adventure #newbrunswick #gooutside #activeon
Apr 19 Social Instagram Love those north woods sunsets! . . . . . . . #explore #explorewisconsin #TravelWI #pinelake #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife #kayakgram_feature #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking
Apr 19 Social Instagram Love having the Fox River so close to home. Always a great paddle. . . . . . . #explore #explorewisconsin #TravelWI #foxriver #appletonWI #onegreatplace #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife #kayakgram_feature #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking #campistco
Apr 19 Social Instagram #dobynsrods #wernerpaddles #shimano #wildernesssystems #astral
Apr 19 Forums NorCal Kayak Anglers Re: GS11 Raffle!!!
Apr 18 Forums NorCal Kayak Anglers Runaway kayak - looking for your comment
Apr 18 Forums NorCal Kayak Anglers Re: Runaway kayak - looking for your comment
Apr 18 Social Wilderness Systems Kayaks FB It's Monday! Who wishes they were here right now? Wilderness Systems Kayaks - Chasing Perfection
Apr 18 Social Instagram Preferred morning coffee sipping spot. . . . . #explore #explorewisconsin #TravelWI #ilovekayaking #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife #kayakgram_feature #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking #kayakcamping #camping
Apr 18 Social Instagram Nothing beats the peace and perfection of paddling a still and crystal clear lake. . . . . . . #explore #explorewisconsin #TravelWI #ilovekayaking #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife #kayakgram_feature #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking #kayakcamping #camping
Apr 18 Social Instagram It was a #ladiesday #90yearsyoung!!!!! (Blue hat) #kayaking #mangroves #Kayakguidedtours #wildernesssystems #Matlacha
Apr 17 Social Instagram #kayaking #kayak #explore #adventure #paddle #wildernesssystems #newbrunswick #gooutside
Apr 17 Social Instagram #paddle #easter #kayak #perceptionkayaks #wildernesssystems #wernerpaddles #upacreek #explore #adventure #iphone #offtrail #dirtbags #nature #outsideisfree #spring #arch
Apr 17 Social Instagram Angie #reflection #outdoorwomen #offtrail #womenwhoexplore #paddle #iphone #kayaking #yaklife #wildernesssystems #explore #creek #upacreek
Apr 17 Social Instagram #easter #paddle #kayaking #yak #upacreek #wernerpaddles #wildernesssystems #perceptionkayaks #offtrail #adventure #dirtbags #iphone #nature @dannyeraydene @kevinmarbury
Apr 17 Social Instagram Beautiful day with @fuzzymemory. #nofilter #nofilterneeded #nature #gonefishing #fishing #kayakfishing #kayaking #chesapeakebay #beach #virginia #coast #outdoors #adventure #atak #wildernesssystems #pennfishing
Apr 17 Social Instagram It was a good birthday weekend. #kayak #subaruwrx #wildernesssystems #weekend #birthdayweekend #austin #atx #austintx #optoutside #outside #kayaking
Apr 17 Social Instagram Hard not to be in love with this view. #britishcolumbia #bc #southerngulfislands #salishsea #gulfislands #penderisland #travel #travelphotography #landscape #landscapephotography #kayaking #paddling #photography #wildernesssystems @wildernesssystems (FYI kayak from @vporeddeer °°)
Apr 17 Forums NorCal Kayak Anglers Re: Wilderness Systems Lithium Battery
Apr 17 Social Instagram Sunset snook release, Everglades City, Florida. Go back and grow up. #snook #snookfishing #flyfishing #everglades #floridafishing #kayakfishing #kayaking #igersjax #wildernesssystems
Apr 17 Social Instagram A paddle through the woods. #kayak #kayaking #explore #explorenb #adventure #gooutside #paddle #adventuretime #wildernesssystems #newbrunswick #peaceful
Apr 17 Social Instagram Great day on the water. #kayaking #wildernesssystems #explorenb
Apr 17 Social Instagram First kayaking trip of the year was a success. #kayaking #wildernesssystems #explorenb #getoutdoors
Apr 17 Social Wilderness Systems Fishing Kayaks FB Look who's using Wilderness Systems Kayaks!
Apr 17 Social Wilderness Systems Fishing Kayaks FB Is there any better feeling? It's that time of year! What are you fishing for this spring? #WildyFishing
Apr 17 Social Instagram One pike tonight but getting to float around was more relaxing #fisheveryday #fishing #kayaking #kayakfishing #wildernesssystems #johnnymorris #bps #puremichigan
Apr 17 Social Instagram 04-16-17: Some of the aquatic plants on 'The Jungle' paddle at Lake Moultrie in Berkeley County SC. They will be in full bloom in a couple weeks. We're planning another trip back. Who wants to #blazethattrail with us? ° #paddling #kayaking #canoe #kayak #canoeing #watertrail #blueway #berkeleycountysc #onlyinsouthcarolina #monckscornersc #photography #discover_sc #discoversc #paddle #swamp #flowers #waterlily #lily #berkeley #berkeleycounty #tours #lake #nikon #water #paddletrail #paddle #wildernesssystems
Apr 16 Social Wilderness Systems Fishing Kayaks FB Over $5000 raised for Heroes on the Water today at the Mission Bay Tournament in San Diego .
Apr 16 Social Instagram Great Easter service then on the water enjoying #nature that the Lord has given ° #OptOutside #outdoors #solitude #kayaking #wolfriverconservacy #wildernesssystems #GoOutside #river #geekprocamera #Easter
Apr 16 Social Instagram 04-16-17: Another pic from today's paddle adventure at 'The Jungle' at Lake Moultrie. This research and photography is for a project for our partners at Berkeley County Economic Development. What a tough day 'at work' for our SC team ° #blazethattrail #coolestcompanies #berkeley #berkeleycountysc #lakemoultriesc #lakemoultrie #onlyinsouthcarolina #discover_sc #discoversc #paddling #kayaking #canoeing #paddletrail #blueway #tourism #lake #photography #nikon #paddle #swamp #cypress #alligator #wildernesssystems #water
Apr 16 Social Instagram 04-16-17: Team BLAZE exploring 'The Jungle' this morning at Lake Moultrie in Berkeley County SC. This will be part of our Berkeley County Guidebook. What an otherworldly place of beauty and adventure #blazethattrail #coolestcompanies #onlyinsouthcarolina #discover_sc #discoversc #berkeley #berkeleycountysc #monckscornersc #monckscorner #paddling #paddletrail #kayaking #canoeing #photography #watertrail #blueway #water #lakemoultrie #lakemoultriesc #moultrie #nikon #bendingbranches #wildernesssystems @bending_branches #tsunami #tsunami175 #tourism
Apr 16 Social Instagram Happy Easter! Entering one of the many intriguing mangrove channels with some fellow paddlers making it out safely #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #miami #southflorida #biscaynebay #outdoors#wildernesssystems #gopro #zephyr160 #miamilife #kayakgram
Apr 15 Social Instagram #wernerpaddles #wildernesssystems #yaklife #freshwater #adventuredog #waterdog #friday #skyporn #cloudlover #clouds #iphone #nature
Apr 15 Social Instagram #paddle #kayak #wildernesssystems #adventure #yaklife #iphone #outdoors #freshwater #wernerpaddles #weekend #friday #outside #skyporn #clouds #cloudlover
Apr 15 Social Instagram 9 nautical mile paddle...Halfway point...still smiling... #livelovelaugh #funfunfun #kayaking #kayaklife #surfskate #justlife #beautifulwife #sober #sobriety #aa #na #narcoticsanonymous #alcoholicsanonymous #savannahgeorgia #savannahriver #tybeeisland #northislandsurfandkayak #thunderboltgeorgia #wildernesssystems #staystrong #waterman #waterwoman
Apr 15 Social Instagram #readytogo прикол в том, что, когда я смотрю на эти лодки, мне хочется плыть на всех одновременно °°° Каждая модель рулится и ведёт себя совершенно по-раному, задавая свой ритм путешественнику. Совсем скоро мрачную серость бетонного фона сменит блеск прозрачной воды и витиеватый узор подмытых еловых корней. Угукание филина и раскатистый всплеск выпрыгивающей рыбы. #grayling #steelhead #salmon #buss #browntrout #trout #tarpon #salmon #shimano #wildernesssystems #nativekayaks #nativewatercraft #oceankayak #kayaking #kayaktours #flyfishing #fly #fishinginrussia #instafishing #instafish #семга #хариус #кумжа #форель #лосось #окунь #щука #русскийсевер #рыбалка #рыбалкавроссии
Apr 15 Social Instagram Great day on the water #kayaking #wolfriverconservacy #wildernesssystems #GoOutside #nature #photography #serenity #fayettecounty #river #OptOutside # geekpro #wernerpaddles
Apr 15 Social Instagram Tent. Hammock. Kayak. YETI full of quality food and beverages. My version of paradise. Went with the @bigagnes_ Big House 6 this weekend. Haven't used it in a few seasons and it's my go to car-camping tent. Didn't need the vestibule on for extra space since it's just me. #camping #getoutside #itsbetterinthewoods #dofunshit #bigagnes #wildernesssystems #kayaking #explore #virginia #yakimaracks #foxoutfitters #hammocktime
Apr 15 Social Instagram Size doesn't matter right... ?? #smallmouth #kayaking #wildernesssystems thankful for spring °°
Apr 15 Social Wilderness Systems Kayaks FB Survey time! Please take a few to help us design new best-in-class products for paddlers like you. After we receive the results, 1 lucky person will be drawn at random to win a $50 credit on Harmony Gear. Rules: Must be experienced with sit inside kayaks to take the survey and qualify for the prize. https://www.surveymonkey.com/r/X2WYN8P
Apr 15 Social Instagram There's a lot worse ways to spend the weekend. #getoutside #camping #explore #virginia #yeticoolers #bigagnes #nemoequipment #wildernesssystems #kayaking #paddleva #arcteryx #deadbirdsociety
Apr 15 Social Instagram #speing creek#esterobay #dogbeach#wildernesssystems #kayaking #kayakswfl #swfl #loverskey #florida#paddling #pictureesque #scenery
Apr 15 Social Instagram Little rewards around every corner on these paddling days. Sorry to disturb this crane, but what a sight! Day #3 . . . . . . #explore #explorewisconsin #blackotterlake #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife @wildernesssystems #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking
Apr 15 Social Instagram Kayak camping! Nice to get off the grid for a minute . @wildernesssystems @bigagnes_ #onnit #getonnit #cavemancoffeeco #cavemancoffee #albanyohd #killthequit #killcliff #kayaking #kayak #jordanlake #nc #nclakes #ryourogue #roguefitness #bigagnes #sunrise #camping #argylestyle #bigheadgym
Apr 15 Social Instagram Went kayaking with Tim at Boggy Creek! #kayaking #fourcreeksstateforest #boggycreek #wildernesssystems #liquidlogic @critters.n.cars
Apr 15 Social Instagram I was finally the one to catch the biggest fish lol. #wildernesssystems #kayakfishing #kayaking #wildflorida #bowfin @critters.n.cars
Apr 15 Social Instagram Afternoon vibes. #easyday #getoutside #camping #kayaking #wildernesssystems #explore #virginia #arcteryx #paddleva
Apr 14 Social Instagram These kids were pretty cool. #SCT #kayaking #traveloregon #thepeoplescoast #wildernesssystems #xcelwetsuits
Apr 14 Social Instagram Late night therapy session #therapy #fishing #kayak #kayaking #BeaverLake #Rogers #rogersAR #RogersArkansas #Bentonville #BentonvilleAR #BentonvilleArkansas #NorthwestAR #northwestarkansas #paddlejunkies #perceptionkayaks #wildernesssystemskayaks #wildernesssystems #beautifulday
Apr 14 Social Instagram If you #paddle and you live nearby you should come #paddling with me next week for #kayakskillsnight Every Thursday, 6pm to 7:30pm. Alternating between just paddling one week and skills the next. Gig Harbor Boat Launch. #paddlingmixtape #kayaking #seakayak #seakayaking #practice #practicemakesperfect #skills #gigharbor #radar135 #helixpd #wildernessystems @eddylinekayaks @stohlquistwaterware @wildernesssystems @wildyfishing @shiptoshoremarine
Apr 14 Social Instagram Spring time in Kherson / Ukraine Gnilusha river 14.04.2017 #kayakingkherson #wernerpaddles #wildernesssystems #kayak
Apr 14 Social Instagram Oleshki-Kherson trip. Approx 15km passed via Konka and Hnilusha rivers .Rainfall, calm, strong wind and blue sky later on met us today. #kayakingkherson #wildernesssystems #wernerpaddles #kayak
Apr 14 Social Instagram WHAT!?! Impex Montauk $800 fiberglass sea kayak ° #WildernessSystems 14.5 ft Seacret $500 ° #perception kayaks Dancer $350 #goplayonthewater #kayaking #regear #kids4cleanwater
Apr 14 Social Instagram #wildernesssystems #wernerpaddles #daiwa
Apr 14 Social Instagram On the Cheat River above the confluence with the Monongahela River. #cheatriver #monongahelariver #kayakingadventures #kayaking #wildernesssystems #perceptionkayaks
Apr 13 Social Instagram A bunch of bass caught tonight!#bass #bassfishing #largemouth #largemouthbass #lake #lakelife #fishing #fishon #fish #lifestyle #kayak #kayaking #kayakangler #kayakfishing #catchoftheday #catchandrelease #nature #spring #springfishing #selfie #addiction #rippinlips #bentrods #chatterbait #bassmaster #wildernesssystems #thetugisthedrug #thegreatoutdoors
Apr 13 Social Instagram Keep an eye on the lower left. Fiesty lil pic! The action was nonstop tonight! #largemouth #largemouthbass #fishing #bassfishing #lifestyle #nature #spring #springfishing #myaddiction #cantstopwontstop #videooftheday #kayaking #kayakangler #kayakfishing #kayak #bassmaster #wildernesssystems #thetugisthedrug #thegreatoutdoors #catchoftheday #catchoftheday #rippinlips #bentrods #lake #lakelife #chatterbait #fun
Apr 13 Social Instagram ready for new adventures, who's down? - #wildernesssystems #wildernessculture #kayaking #kayakfishing #jeep #outdoors
Apr 13 Social Instagram Listen to those frogs! ° Perfect day on the water. Feeling one with nature. . . . . . #explore #explorewisconsin #kayaklyfe #lifeisgood #wildernesssystems #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking @wildernesssystems #iphone7 #daytripper #carlislepaddles #createexplore #liveauthentic #kayaklife #paddleliving
Apr 13 Social Instagram Made a new dog-deck for#hisfluffiness on the #tsunami145 Pretty sure he's going to love it! #paddleday #wildernesssystems #kayaking
Apr 13 Social Instagram On the James River under the CSX A-Line bridge. #rva #kayakingadventures #kayaking #wildernesssystems #virginia
Apr 13 Social Instagram It'll take more than a grey day to keep me away! . . . . #explore #explorewisconsin #blackotterlake #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking #kayaklife @wildernesssystems #olympusomdem5 #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene
Apr 12 Social Instagram So I guess leaving the coast isn't so bad when we have a river like this to kayak on. #hillsboroughriverstatepark #kayaking #wildernesssystems
Apr 12 Social Instagram Virginia Key stop always gives a great shot of Downtown Miami across Biscayne Bay #FLATkayak #florida #adventure #touring #kayak #kayaking #miami #southflorida #downtownmiami #virginiakey #biscaynebay #portofmiami #gopro #wildernesssystems #zephyr160
Apr 12 Social Instagram Kayaking Saluda River with my little sister. It was her first time and she is obviously a natural adventurer. #kayak #wildernessculture #wildernesssystems #adventure #stayoutside #saludariver #southcarolina #family #kayaking #shesanatural #outdoors #onthewater
Apr 12 Social Instagram Watch as Ian explains the benefits of the @wildernesssystems NEW Helix pedal drive on our demo kayak! Come try it out for yourself on our lake today!
Apr 12 Social Instagram First day out kayaking of the year, couldn't have asked for a better one! ☀️☁️ * * * #kayaking #sunnyday #lakecochituate #outdoors #outside #getoutside #optoutside #goeast #wildernesssystems #kayak #lake #photo #photooftheday #picoftheday #in2nature #keepitwild #neverstopexploring #lifeofadventure #blueskies #sunset #sunshine #spring #springday #explore #exploremore #adventure #roamtheplanet #nofilter #nofilterneeded @easternmntnsports @wildernesssystems @pineandwater @ig_massachusetts @massachusettsoutdoors
Apr 12 Forums /r/Kayaking Choosing kayak hull material
Apr 12 Social Instagram Committing to paddling a lot more, smiling more and breathing deeper. Day 2 . . . . . #explore #explorewisconsin #blackotterlake #chainolakes #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking #kayaklife @wildernesssystems #olympusomdem5 #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving
Apr 12 Social Wilderness Systems Fishing Kayaks FB Follow YakFish TV Robert Field in his ATAK 140 and Bert and Dan Rodriguez on the redemption trip of a lifetime down the wild and beautiful Pecos River in Southwest Texas. Watch PART 3 of Surviving the Pecos at the LINK HERE: http://bit.ly/ReturnToPecos_PartThree #wildyfishing
Apr 12 Social Wilderness Systems Fishing Kayaks FB 5 Tactics from pro staffer Drew Haerer that put big bass in the kayak when the ice starts melting. #wildyfishing http://www.wildernesssystems.com/us/experience/team-blog/297/post/five-ice-out-lures-and-techniques-catch-big-bass
Apr 12 Social Instagram Paddle Day 2 . . . . . #explore #explorewisconsin #waupaca #chainolakes #lifeisgood @patagonia #wildernesssystems #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking @wildernesssystems #iphone7 #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving
Apr 11 Social Instagram No hogs today but still caught a bunch of bass! #bass#bassfishing #bassmaster #largemouth #largemouthbass #fishon #fish #catchoftheday #catchandrelease #selfie #fishing #freshwater #freshwaterfishing #angler #fisherman #nature #thegreatoutdoors #thetugisthedrug #lake #lakelife #kayak #kayaking #kayakangler #kayakfishing #wildernesssystems #picoftheday #rippinlips #bentrods #fishon
Apr 11 Social Instagram Kayaked 14miles yesterday on the Mulberry and I am feeling it today!!! #yeti #yeticoolers #yetiroadie #tarpon100 #kayaking #yaklife #yakaddicts #wildernesssystems #adventure #adventuretime #adventures #kayak #kayakingadventures #mulberryriver #corebrewery #nature #natureporn #natureaddict #fun
Apr 11 Social Instagram Peanut butter and jelly. Get it? #oakisland #paddlefaster #wildernesssystems #water #springbreak2017 #jellyfish #lowtide #kayaking #kids
Apr 11 Social Instagram Exactly two years I took my sea kayak for a spin. Some sort of jellyfish about. Have been whitewater kayaking over 13 years now. Time flies... Certainly am getting grey hairs now ° @wildernesssystems #seakayaking #seakayak #kayaking #kajak #kayak #kayakingislove #capetownmag #lovecapetown #westcoast
Apr 11 Social Instagram The fun kids of Oak Hill School on the Chetco. #wildernesssystems #kayaking #SCT #xcelwetsuits
Apr 11 Social Instagram #kayaking #kayakingflorida #florida #swfl#marcoisland #tenthousandislands #pictureoftheday #sundayfunday #wildernesssystems #valleykayaks
Apr 11 Social Instagram I feel truly addicted to fishing.Its always on my mind. I'll do it in the rain, the heat, the cold and the wind. I guess there's worse things to be addicted to!#fishing #freshwaterfishing #bassfishing #kayakfishing #kayakangler #kayaking #kayak #wildernesssystems #picoftheday #catchandrelease #rippinlips #bass #largemouth #largemouthbass #spring #springfishing #nature #thegreatoutdoors #thetugisthedrug #bentrods #fishon #fish #lake #lakelife #addiction #hobbies #lifestyle
Apr 11 Social Instagram The other Oak Hill school crew on the Chetco. These guys braved a little early rain while maintaining good attitudes. #xcelwetsuits #wildernesssystems #thepeoplescoast #traveloregon #SCT #kayaking
Apr 11 Social Instagram When brewers go kayak camping, we pack a corny keg. . . . . . . #explore #explorewisconsin #discoverwisconsin #lifeisgood #beer #drinkwisconsinbly #kayakcamping #wildernesssystems #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking @wildernesssystems #iphone7 #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving
Apr 10 Social Instagram Paddle practice! (I may have fallen in) #kayaking #parklake #dogonaboat #sundayfunday #newkayak #wildernesssystems #tsunami145
Apr 10 Forums NorCal Kayak Anglers Re: GS11 - 5/20/17 - Thank you, Wilderness Systems! Radar 135 and Paddle for raffle!
Apr 10 Social Instagram My smallest bass from yesterday but he still has my respect appreciation! #bass #bassfishing #largemouth #largemouthbass #thetugisthedrug #fishing #freshwaterfishing #catchoftheday #catchandrelease #picoftheday #thegreatoutdoors #spring #nature #kayak #kayaking #kayakangler #kayakfishing #bentrods #tightlines #rippinlips #selfie #fish#fishon #bassmaster #wildernesssystems
Apr 10 Social Instagram Join us on April 22 for our Earth Day Demo Day event in Morro Bay @ Coleman Beach. Try before you buy! #prokayakfishing #centralcoastkayaks #wildernesssystems #jacksonkayak #vibekayaks
Apr 10 Social Instagram Another April paddle. . . . . . #explore #explorewisconsin #waupaca #chainolakes #lifeisgood @lifeisgoodco #wildernesssystems #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking @wildernesssystems #iphone7 #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic
Apr 9 Social Instagram It's been a long day of paddling and enjoying gods gifts. A much needed day of relaxing was a success. #forgottencoast #kayaking #kayakfishing #panacea #livelifeoutdoors #gulfofmexico #wildernesssystems #adventuretechnologypaddles #pennfishing
Apr 9 Social Instagram Great day today at our Fishing Kayak Demo Day at the John E. Pechmann Fishing Education Center in Fayetteville, NC. Thanks to all who came out! Looking for a unique, family-oriented fishing experience? Come visit the John E. Pechmann Fishing Education Center in Fayetteville, N.C. Built in 2007, the Pechmann Center is the N.C. Wildlife Resources Commission’s newest education facility and is the only fishing education center of its kind in North Carolina. Center instructors teach a variety of aquatic programs to anglers of all ages and abilities. #hooklineandpaddle #pechmannfishingeducationcenter #fayettevillenc #kayakfishing #fishingkayak #fishing #education #ncwildlife #demoday #kayakangler #bassfishing #nativewatercraft #wildernesssystems #jacksonkayak @christryonhlp
Apr 9 Social Instagram Trying out the pedal drive! @yaktribe @sh_ne @wildyfishing #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #sundays #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #wildernesssystems #Wildyfishing
Apr 9 Social Instagram Even if you're not looking to buy a new kayak or paddleboard, get to Lake Julian before 2:00 to paddle our demo fleet for FREE on a stunningly perfect spring day! #adventureislocal #diamondbrandoutdoors #lakejulian #water #paddle #kayak #kayaks #kayaking #sup #paddleboarding #standuppaddle #828isgreat #avl #free #asheville #ashevillenc #arden #buncombecounty @liquidlogickayaks @nrsweb @wildernesssystems @astralfootwear @chacofootwear @keen @nativewatercraft @hurricanekayaks @wernerpaddles
Apr 9 Social Instagram Introducing #ariakayaks Follow us to watch our favorite 3y/o #littleadventurer explore and conquer the world, one paddle at a time. :) #isthiskayakgoingaroundyet? #kayaking #spacecoast #brevard #orlando #letsgo #haulovercanal #manatees #dolphins #bioluminescence @wernerpaddles do you make a paddle for someone 36inches tall? ° @wildernesssystems you got a booster seat for a pamlico?
Apr 9 Social Instagram It has arrived! The long anticipated Helix Pedal Drive, a drop in for the Wilderness Radar 115 & 135. If you have been waiting for one, come on in! . . . . . . . . #canoecountryfl #ccofl #wildernesssystems #helixpd #pedaldrive #radar #kayak #kayaking #kayakfishing #paddling #stpete #tampabay #florida
Apr 9 Social Instagram Kai-yaking #kayaking #wildernesssystems #outdoors #northoconeeriver
Apr 9 Social Instagram Kayaking and birding the Yadkin River today. We found 50 species over 16.3 miles #kayaking #wildernesssystems #garmin #nc #winstonsalem #yadkinriver #birding
Apr 8 Social Instagram #kayak #kayaking #kayakfishing #penn #shakespear #wildyfishing #wildernesssystems #ride135 #ray #dogfish #whiting #barry #coldknap #southwales #uk #summersday #daysout #fun #paddling #friends
Apr 8 Social Instagram How do you haul your yak? #campingwithmykayak #camping #optoutside #getoutthere #kayaking #ipadventures #xterra #wildernesssystems #generaltires
Apr 8 Social Instagram Kayaking the deep river,nc river is super high. Only place to stop was under a bridge. Live that hobo life! #kayak #kayaking #wildernesssystems #ncriver #nc #albanyohd #onnit #getonnit #cavemancoffee #cavemancoffeeco #killthequit #killcliff #lifegoals #argylestyle #bigheadgym
Apr 8 Social Instagram Bring a dog, bring a friend. Bring someone you love, bring someone you hate. Just make sure you make it to Lake Julian on Sunday to try out our kayaks + SUPs! #adventureislocal #lakejulian #kayak #sup #paddleboarding #kayaks #kayaking #828isgreat #lake #sundayfunday #outdoors #diamondbrandoutdoors @liquidlogickayaks @nativewatercraft @hurricanekayaks @nrsweb @wildernesssystems @wernerpaddles @astralfootwear @chacofootwear @keen
Apr 8 Social Wilderness Systems Kayaks FB Wilderness Systems Kayaks updated their profile picture.
Apr 8 Social Wilderness Systems Kayaks FB Wilderness Systems Kayaks updated their cover photo.
Apr 8 Social Instagram Let the protein bar and kayaking season begin... Macros: Cal 200/Carb 23 g/Fat 7g/Pro 21g #simplefitfood #simplefitfoods #macroswithjen #pureprotein #kayaking #protein #wildernesssystems #summer
Apr 7 Social Instagram What a wonderful spring day to unload some @wildyfishing @wildernesssystems and @perceptionkayak kayaks. The best part, now the @bluwavesup shipment has also arrived! #kayaks #standuppaddleboards #goretexiswonderful
Apr 7 Social Instagram Hello Friday! Hello weekend! Hello adventure! We are obviously excited to see you... #wildernesssystems #kayak #kayaking #welcomeweekend #weekend #weedonisland #fun #funnyfaces #funnyface #adventure #adventuring #explore #outdoors #outdoor #florida #exploreflorida #tampabay #saltlife #enjoylife
Apr 7 Social Instagram Bass on Frogger Bomber Fly tied by Johnny Martinez / www.johnnyonthefly. #flytying #lakeathens #bassonthefly #flyfishing #flyfishingaddict #onthefly #topwaterbite #rioflylines #tfomangrove #orvissouthlake #fortworthflyfishers #backwoodsfortworth #imkmark #jstockard #lumixgh3 #repyourwater #keepemwet #redingtongear #wildernesssystems #kayakflyfishing #kayakbassfishing #pakpod #wernerpaddles
Apr 7 Social Instagram Miss you baby °°°° see you soon #paddle #paddlelakedillon #cravingkayaks #wildernesssystems #kayaking #lakedillon #summitcounty
Apr 6 Social Wilderness Systems Fishing Kayaks FB Watch Part 2 of 'Surviving the Pecos River' with Robert Field of YakFish TV as they take on another leg of this bucket list fishing expedition. Watch the full length VIDEO HERE: https://goo.gl/jjG3EN #atak140 #wildyfishing
Apr 5 Social Instagram Inauguration Day for the RADAR 135. In enjoying how it paddles and handles thus far. Plenty of stability for sight casting. #wildyfishing #wildernesssystems #radar135 #pennreels #uglystik #gulp #bendingbranches #obx #kayaking #kayakfishing
Apr 5 Social Instagram It's been a while since I've been able to get out on the water but finally made it out again and went to one of my favorite spots, Chicken Key #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #paddlemixtape #outdoors #outdoorlife #islandlife #winter #wildernesssystems #gopro #howtodoflorida #kayakgram #kayaklyfe #lowtide #zephyr160 #biscaynebay #miami #miamilife #chickenkey
Apr 4 Social Wilderness Systems Fishing Kayaks FB Wilderness Systems Fishing Kayaks updated their profile picture.
Apr 4 Social Instagram The put in spot at Wolfpen this weekend!! #kayaking #kayak #yaklife #mulberryriver #adventure #adventures #kayakgram #kayakingadventures #kayaklove #wildernesssystems #tarpon100 #jacksonkayak #vibekayaks #jacksoncoosa #yellowfin100 #nature #naturelovers #natureporn #whitewater #rapids #theozarks #thewoodsman #yakaddicts #fayettechill #outdoors #outdoorlife #fun
Apr 4 Social Instagram New YouTube video in the works! Helix peddle drive unboxing. °°#yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #sundays #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #wildernesssystems #Wildyfishing #helixpeddledrive
Apr 4 Social Wilderness Systems Fishing Kayaks FB Watch and learn how Jeff Little of Tightline Junkie Journal consistently catches huge stripers from his kayak! VIDEO LINK: https://tightlinejunkiejournal.pivotshare.com/media/early-spring-shallow-water-stripers/60477/preview
Apr 4 Social Wilderness Systems Fishing Kayaks FB In this episode, Chad Hoover teams up with Gene Jensen to host a kayak bass fishing seminar at Florida’s legendary Bienville Plantation. The Sportsman Channel #knotrightkayakfishing #kayakbassin #KBF See AIRING SCHEDULE here: https://goo.gl/Lg4bao
Apr 4 Social Instagram Got my ass handed to me today but still pulled out a slam by 10am! Talk about a mouth full!! . . . #mirrolure #catchjr #snook #kayakfishing #flatsfishing #saltwaterexperience #windy #smallcraft #kayaking #flatsfishing #atak140 #wildernesssystems #yakanglers #yakattack
Apr 3 Social Instagram Picking wild blackberries from the yak. #kayakfishing #kayaking #wildernesssystems #kayak
Apr 3 Social Instagram #sundayfunday #chaconation #kayaking #kayakingadventures #camping #hiking #At17workout #sectionhikeworkout #wildernesssystems #justdoit #optoutside #outdoors
Apr 3 Forums NorCal Kayak Anglers Re: Viking Reload
Apr 3 Social Instagram #kayak #kayaking #tarpon120 #wildernesssystems
Apr 3 Social Instagram Lil' man tracking' like a pro. I think he's hooked. #lakehickory #kayaking #relax #weekends #wildernesssystems #oldtownkayak #familytime #novideogames #outdoorliving #prouddad
Apr 3 Social Instagram Hello gorgeous Arizona weather! Took the kayak and SUP out today for the first lake day of the year! . . #lindsirianphotography #arizonaphotographer #adventurephotographer #outdoorphotographer #landscapephotographer #utahphotographer #coloradophotographer #pnwphotographer #caphotographer #nationalparkphotographer #explore #adventure #getoutdoors #optoutside #rei1440project #whatsyour20 #adventurous #roadtrip #nature #keepitwild #SUP #wildernesssystems #advancedelements #suparizona #canyonlake #tortillaflat #arizona
Apr 2 Social Instagram Awesome day for a Demo Day! Big thanks to all who came out today! #hooklineandpaddle #demoday #fishingkayak #kayakfishing #bassfishing #fishing #kayakangler #kayak #kayaking #paddleboarding #paddleboard #fishingpaddleboard #wilmingtonnc #inshorefishing #offshorefishing @christryonhlp @02seedoc #nativewatercraft #liquidlogic #wildernesssystems #perceptionkayaks #jacksonkayak #yoloboard #livewatersports #soloskiff #astral #accentpaddles #immersionresearch #boonedoxusa #capefearelements #drycase #surfershealingnorthcarolina
Apr 2 Social Wilderness Systems Fishing Kayaks FB Watch our friend Robert Field from YakFish TV style it in the A.T.A.K. 140 in the epic Return to the Pecos - Part One: http://bit.ly/ReturnToPecos_PartOne PS - we're pretty sure Robert said that the A.T.A.K. was the only kayak not to turtle through the rapids. #WildyFishing
Apr 2 Social Wilderness Systems Fishing Kayaks FB Over 300 kayak anglers at the KBF National Championship captains meeting lastnight. Who's taking home the $35,000 win?
Apr 2 Social Instagram The mulberry was a flowin' this weekend!!!! #mulberryriver #kayaking #yaklife #getoutside #adventure #adventures #kayak #whitewater #nature #natureporn #naturelovers #natureaddict #fayettechill #thewoodsman #kayakgram #wildernesssystems #tarpon100 #vibekayaks #jacksonkayak #kayakcamping #floating #floattrip #fun #theozarks #ozarks #kayakingadventures #yeti
Apr 2 Social Instagram Took off at Loosier Lake yesterday in the #ride115x and #tarpon100 from @wildernesssystems - and had a pretty great day minus the extreme sunburn we endured.#kayaking #kayaks #kayakfishing #kayakbassfishing #bass #bassfishing #backwaters #fishing #alabamafishing
Apr 1 Social Instagram SHOP TOUR: Stop by Saturday, April 1st and check us out for huge storewide savings on kayaks, fishing kayaks, paddleboards, and gear! Demo day at Smith Creek County Park from 11am-3pm. #hooklineandpaddle #shoptour #fishingkayak #kayakfishing #bassfishing #fishing #kayakangler #kayak #kayaking #wilmingtonnc #inshorefishing #offshorefishing @christryonhlp #beachlife #nativewatercraft #nativewatercrafttitan #liquidlogic #wildernesssystems #wildyfishing #perceptionkayaks #daggerkayaks #jacksonkayaks #jacksonkayak #yoloboard #yolo #livewatersports #soloskiff #shoplocal
Mar 30 Forums /r/Kayaking Who says you can't have a kayak in an apartment? My new Wilderness Systems Pungo 140.
Mar 29 Forums /r/Kayaking Aspire 105 worth it?
Mar 26 Forums /r/kayakfishing I found a great deal on craigslist so made the purchase.
Mar 26 Social Instagram We had a great day at the Mid-Ohio Valley Sportsmans expo! Even got to share my love of kayak fishing through a seminar! Best of all, we saw several men make decisions to follow Christ! Thanks to all the vendors and volunteers who helped make this event a success! #mska #kayakbassin #kayak #kayakfishing #kayakangler #kayakangling #midohiovalley #sportsman #expo #seminar #outreach #fishing #outdoors #ministry #follow #teach #klmworms #wildernesssystems #jacksonkayak #mariettaadventurecompany #greatoutdoors
Mar 25 Social Instagram Just another day of paddling for Biscuit the Adventure Dog °. . . . . . #thevacationmachine #LiveRiveted #MyLiveRivetedLife #airstream #airstreamsafari #GoRVing #rv #camping #GetOutside #Wanderlust #goprohero5 #kayaking #kayakingkids #kayakingdog #campingdog #littleredriverar #rockmonkeyoutfitters #jacksonkayaks #wildernesssystems
Mar 25 Social Instagram Tea Break! Perfect conditions on Lake Windermere yesterday. Spent the whole day been buzzed by jets! #kayaking #kayak #jetboil #lakedistrict #windermere #lakes #lakeland #ambleside #wildernesssystems
Mar 25 Social Wilderness Systems Kayaks FB HELP our Research & Development efforts by taking a quick 7 question survey about your paddling trips! SURVEY: https://www.surveymonkey.com/r/Z3BBQ79
Mar 25 Social Instagram Ingulka river Kherson Region Ukraine #wildernesssystems #wernerpaddle #kayaking #rest_in_kherson
Mar 25 Social Instagram Thanks Nancy and family for going #kayaking with #blazinpaddles today. #beauty #beautifulweather #beautiful #blackcanyon #blazinpaddlestour #iphone #gopro #lasvegas #offthestrip #mercedes #aquabound #wildernesssystems #hooverdam #willowbeach #emeraldcave
Mar 25 Social Instagram Summer come soon °°#taylorreservoir #wildernesssystems #kayaking #happyplace #summer #coloradoskies #colorado
Mar 24 Social Wilderness Systems Fishing Kayaks FB The highly anticipated Helix PD™ Pedal Drive has officially launched! Arriving soon to a Wilderness Systems dealer near you. https://goo.gl/tBZ8qc
Mar 24 Social Instagram It was a LONG day, but it ended great! Let the rigging begin. #wildyfishing #radar135 #atak120 #kayak #kayaking #kayakfishing #fishing #paddle #wildernesssystems #midnight #boat #boats #plastic
Mar 24 Videos Youtube RAM Totalscan Transducer Arm Install on Kayak
Mar 23 Social Instagram Thinking back to last summer. First day on the water in the new boat. Hard to forget that first fish. #kayakfishing #wildyfishing #fishing #northernpike #wildernesssystems #wernerpaddles
Mar 23 Social Instagram LIVRAISON SPÉCIALE: Les kayaks @DaggerKayaks @WildernessSystems @PerceptionKayak sont arrivés en magasin ce matin! #KayakQuébec #Kayaks #Kayaking #WildernessKayaks #PerceptionKayaks #DaggerKayaks #Kayak #QuébecKayak
Mar 23 Social Instagram Always hard to be at work when you know you got one shift left before a whole weekend on the lake. Shasta bound tomorrow! #hobie #wildernesssystems #icouldntpickaboat #dobynsrods #lewsreels #charmerbaits #fishermansheadquarters #wishinitwaskentuckylake #gopro #nrs #wernerpaddles #lowrance
Mar 22 Social Instagram #romega #georgiasrome #exploregeorgia #wandernorthga #etowahriver #OptOutside #roamwithlions #wildernesssystems #tarpon100 #kayaking #riverlife #riverrat #getoutsidegeorgia #werner #northgatreks #getoutside #wildernessculture #fiftyshades_of_nature #myhappyplace #thegoodlife #discovering_captures
Mar 22 Social Instagram Hook, Line & Paddle's Annual Spring Demo Day Saturday, April 1st from 11-3 at Smith Creek Park in Ogden. Try different kayaks, fishing kayaks, pedal kayaks, paddleboards, & fishing paddleboards! Come try before you buy! Big Thanks to New Hanover County Parks! #hooklineandpaddle #demoday #newhanovercountyparks #kayak #paddleboard #sup #fishingkayak #nativewatercraft #liquidlogic #jacksonkayak #wildernesssystems #perceptionkayaks #yoloboard #yolo #livewatersports #live2fish #thule #astral #accentpaddles #drycase #boonedox #orioncoolers @nhcparks @wectnews @frances.weller @wwaynews @starnewsonline @christryonhlp #smithcreekpark #wrightsvillebeach #figure8island #carolinabeach #portersneck #fayettevillenc
Mar 22 Social Instagram Ooh la la! Our boat room is full! We have boats in a variety of sizes, colors, and purposes and they are ALL looking for a good home. Get your boat and gear and get ready to paddle - spring is here! #paddlefxbg #kayaks #kayakfishing #kayakadventures #getoutside #letthegoodtimesflow #riverlife #jacksonkayak #wildyfishing #wildernesssystems #dagger
Mar 22 Social Instagram Yes afternoon was so beautiful the whole BE team @rvmetalshop @ekspottery @stacicripps @guilded_tongue skipped out to go kayaking! We truly have the most incredible team!!! Nothing like a little time on the water to reset. #kayakingfun #kayaking #exploregeorgia #wildernesssystems #thelakeiscalling #georgia #wandernorthga #beoutside #optoutside #optoutdoors
Mar 22 Social Instagram Spring break and 80 degree weather means jumping in the kayak for an early spring paddle! °☉ #kayak #paddle #yakattack #wernerpaddles #wildernesssystems
Mar 22 Social Instagram Trinity River Bass on the Fly #fortworthflyfishers #txflyfishingfestival #trinityrivervision #onthefly #kayakflyfishing #kayakbassfishing #kayakbassfishingmagazine #lumixgh3 #wildernesssystems #largemouthbass #orvissouthlake #tfomangrove #wernerpaddles #streamerflyfishing #catchandrelease #trinityriverfortworth #backwoodsfortworth #flyfishing #thetugisthedrug #fishporn
Mar 22 Social Instagram Once this snow and ice melts I'll be back on the water hunting big bass, can't wait!#wildernesssystems #kbf #yakattack #yakaddicts #powerpole #kayakbassfishing #kayakfishing #bassmaster #bassfishing #bassuniversity #kokatat #freshwaterfishing #kayaktournamentangler #bassfish #fishing #fishinglife #ikelive
Mar 22 News Kayak Angler Magazine Three Tips To Mastering Your Fishing Bait
Mar 20 Social Wilderness Systems Fishing Kayaks FB Exclusive and free access to the latest issue of Kayak Angler magazine. Spring 2017 copy available now at the link below. https://www.rapidmedia.com/kayakangler/categories/news/8488-issue-preview-spring-2017
Mar 18 Forums /r/kayakfishing Wilderness Systems Ride 135
Mar 17 Videos Youtube Wilderness Systems Tarpon 120 kayak
Mar 16 Forums /r/kayakfishing Wilderness Systems Radar 115
Mar 15 Social Wilderness Systems Fishing Kayaks FB Pro Rig your Radar 135 into a fully tri-powered yak. Capable of efficiently switching between power modes for any fishing scenario. http://www.wildernesssystems.com/us/experience/team-blog/297/post/jeff-little-maiden-voyage-and-rigging-radar-135
Mar 14 Social Instagram Emerald waters.#kayaking #westernaustralia #ocean #mainpeak #wildernesssystems #tsunami #sea
Mar 13 Social Instagram Small lake. 7-10lb bag is good. #fish #fishing #bassfishing #panfishing #largemouth #largemouthbass #blackbass #crappie #blackcrappie #shimano #pline #ownerhooks #yamasenko #filthy #filthyanglers #certifiedfilthy #columbiasportswear #uafish #wildernesssystems #tarpon120 #kayak #kayaking #kayakfishing fishing #alhambra #antioch
Mar 13 Social Instagram Does your tandem partner leave you #paddling solo like my little buddy did here? #islandboys #jossandemit #wildernesssystems #stohlquist #paddlingwithkids #kayakgram_feature #kayaking
Mar 13 Social Instagram Don't forget to take a friend to the great outdoors!!! Get out there!!! #kayaking #camping #gopro #motivation #pnw #thetimeisnow #paddlelife #paddle #wildernesssystems
Mar 13 Social Instagram (Swipe left to view all pics) Chris Tryon and Michael Snyder setting up for today's Kayak Showcase & Seminar at Porter's Neck Plantation & Country Club Recreational Center. Thank you so much for the invitation and hospitality! We look forward to paddling with y'all! #hooklineandpaddle #portersneck #portersneckcountryclub #wilmingtonnc #kayak #kayaking #kayakfishing #fishingkayak #familyfun #lovewhereyoulive #guestspeaker #nativewatercraft #liquidlogic #wildernesssystems #jacksonkayak #perceptionkayaks #daggerkayaks @christryonhlp
Mar 12 Social Instagram Kayaking is my happy place. #kayak #kayaking #happyplace #wildernesssystems
Mar 12 Social Instagram #paddling #8miles #townlake in my #beautiful #hometown #austintexas #stohlquist #mammut #wernerpaddles #wildernesssystems #ackvibes @austin_kayak @roguexpeditions @stohlquistwaterware
Mar 12 Social Instagram Morning on the water at Lake Powell °°#livesimply #ownlessstuff #liveyouradventure #coupleswhotravel #camper #nomad #lifeontheroad #happycamper #camp4pics #in2nature #ourcamplife #keepitwild #wearestillwild #morningscenes #morningslikethese #vscoedit #lifewelltraveled #travelandlife #kayakfishing #kayaking #wildernesssystems
Mar 11 Social Instagram Still with a high of 56...It's gonna be chilly on the water today. #kayaking #kayak #scstateparks #wanderlust #discoversc #exploresc #cherawstatepark #lakelife #wildernesssystems #weather #southcarolina
Mar 11 Forums /r/Kayaking Newbie looking for advice (Bois Brule River, WI)
Mar 11 Social Instagram Saturday paddle out around Budd Keys on our way to Tarpon Belly Key. #florida #floridakeys #kayaking #wildernesssystems
Mar 10 Social Instagram Setting up for tonight's kayak fishing seminar by Chris Tryon at the Compass Pointe Community Fishing Club Meeting. Thanks for the invite and hospitality Joe! #hooklineandpaddle #compasspointe #compasspointenc #lelandnc #kayakfishing #kayak #fishing #fishingclub #resortliving #nativewatercraft #jacksonkayak #wildernesssystems #liquidlogic #perception #yoloboard #yolo #live2fish #soloskiff #fishinglife #lovewhereyoulive
Mar 10 Social Instagram Where are you setting up camp this weekend? Get out there!!! #getoutthere #ipadventures #gofsr #getoutside #xterra #kayaking #wildernesssystems #hiking #climbing #optoutside #overland #adventure #adventuretravel #adventuretrailer
Mar 10 Social Instagram It's a Beautiful day for a Paddle!!°°: @jason_hoss Located @robbiesofislamorada #kayakshack #bucketlist #thingstodo #islamorada #flkeys #floridakeys #floridakeyskayak #keyslife #views #saltlife #southflorida #soflo #islandlife #islamoradatimes #beautifuldestinations #kayaklife #perceptionkayaks #wildernesssystems #adventure #bendingbranches #kayaks #kayaktour #kayaking
Mar 9 Social Wilderness Systems Kayaks FB Your feedback helps us make customized product designs and stay at the forefront of kayak innovation and quality. Let us know what you want by taking this six question survey. Thank you for your support! http://survey.constantcontact.com/survey/a07edw6l9f3izst8h7v/start
Mar 9 Videos Youtube Alligator Gar Busts Through Net - EPIC Kayak Fishing Day Wilderness Systems ATAK 140
Mar 9 Social Instagram °°° - - - @wernerpaddles @wildernesssystems @kayakgram #latepost #wednesday #yesterday #river #kayak #florida #wild #spring #paddle #fl #getoutstayout #nature #pic #neverstopexploring #outdoors #kayaking #boat #nomad #chilly #water #blue #springs #latergram #potd #thegreatoutdoors #travel #photo #getoutside #kayaklife #latergram
Mar 9 Forums /r/kayakfishing Looking for opinions on my first fishing kayak.
Mar 9 Social Instagram SCT is so stoked to have 3 smart and powerful women guides in 2017! #SCT #thepeoplescoast #kayaking #oceankayak #traveloregon #wildernesssystems #hobiesup #nrs
Mar 9 Social Instagram No rack and a soft top..... pool noodles and a couple ratchet straps will get er home! Yes, a rack is in my future! My new #wildernesssystems Tarpon 120 sit on top kayak, can't wait ! #jeep #jeepwrangler #jku #lakestclair #kayaking
Mar 8 Social Instagram 2017 boats have arrived. #perceptionkayaks #daggerkayaks #wildernesssystems #fatjimmysoutfitters #kayak #kayaking #kayakfishing
Mar 8 Social Instagram Eat.Sleep.Paddle.Repeat #ichetuckneeriver #ichetucknee #springs #florida #naturalflorida #naturalresource #saveoursprings #freshwater #paddle #kayak #river #necky #neckykayaks #wildernesssystems #wildernessystemskayaks #werner #wernerpaddles #adventure #optoutside #getoutside #nature #happyplace #adventure #adventureiswaiting #sunshine #sunshinestate #riverrats #aquaticnomad #rivertramp #drifter
Mar 7 Social Wilderness Systems Fishing Kayaks FB Take this 6 questions survey from our R&D team and tell us what you want on the water. Thank you for your support! http://survey.constantcontact.com/survey/a07edw6l9f3izst8h7v/start
Mar 6 Social Instagram Can't wait to get back on the water! . . . . . . . . #liveauthentic #travel #adventurethatislife #wisconsin #adventure #vanlife #projectvanlife #kayak #kayaking #wildernesssystems #bendingbranches #lifeisgood @wildernesssystems #photooftheday #adventurevisuals #photography
Mar 6 Social Instagram Find you beach!!! #lookwhatifound #ipadventures #canon #camping #wildernesssystems #beachlife #gofsr #kayaking
Mar 6 Social Wilderness Systems Fishing Kayaks FB Your feedback helps us make customized product designs and stay at the forefront of kayak innovation and quality. Let us know what you want by taking this six question survey. Thank you for your support! http://survey.constantcontact.com/survey/a07edw6l9f3izst8h7v/a001izybinkg/questions
Mar 5 Social Instagram We kayaked at Alligator River today. Finally heard a Barred Owl in Dare County too. #kayaking #wildernesssystems #garmin #alligatorriver #obx
Mar 5 Social Instagram After dinner paddle!!! #ipadventures #pnw #gofsr #kayaking #lakelife #wildernesssystems #optoutside #getoutthere
Mar 5 Social Instagram Sexy beach photo shoot #FLATkayak #florida #adventure #touring #kayak #kayaking #outdoors #outdoorlife #paddle #paddling #paddlemixtape #kayakgram #kayaklyfe #keybiscayne #winter #wildernesssystems #america #atlanticocean #gopro #howtodoflorida #zephyr160 #biscaynebay #miami #miamilife #beach
Mar 5 Social Instagram Ice on the Wenatchee river. #kayak #kayakninja #wildernesssystems #wenatcheevalley #wenatchee #wernerpaddles #wernerikilos #pnw #pnwlove #washingtonstate #paradise
Mar 5 Social Instagram Excellent selections of #fishingkayak from @oexpointloma @oexsunstbeach and @oexmissionbay. #fredhallshow Long beach.. . #fishingkayaks #kayakfishing #kayaking #kayaker #paddlesports #kayak_fish #SUPsurf #supfishing #kayakstorage #perceptionkayaks #supstorage #oceankayak #oceankayaking #boatdock #waterfront #paddlesurf #fishingboat #flyfishing #supsurf #bassfishing #malibukayaks #wildernesssystems #fishinggear #fishingsupplies #fishingkayakstorage #lajollacove #paddleboarder #missionbay
Mar 4 Social Instagram #happyfriday #friday #kayak #kayaking #BeaverLake #Rogers #rogersAR #RogersArkansas #Bentonville #BentonvilleAR #BentonvilleArkansas #NorthwestAR #northwestarkansas #paddlejunkies #perceptionkayaks #wildernesssystemskayaks #wildernesssystems #beautifulday
Mar 4 Social Instagram #kayakninja #wildernesssystems #wenatcheevalley #wenatchee #wernerpaddles #wernerikilos #pnw #pnwlove #washingtonstate #paradise
Mar 4 Social Instagram At the #portlandmaine Boat show repping #kitterytradingpost #wildernesssystems #oldtownkayak #kialoapaddles #surftech #wernerpaddles #yeticoolers #bicsup #standuppaddle #kayak #maine #summer
Mar 4 Social Instagram Enjoying time on the water at Old Hickory above the dam in the Wilderness Systems Kayaks Zephyr Pro 155. What do you paddle? #wildernesssystemskayaks #HOOK1 #Kayak #Kayaking #Paddle #paddling #Paddlelife #Wildernesssystem #zephyr
Mar 4 Social Instagram Biscayne Bay on one side and the Atlantic Ocean on the other #FLATkayak #florida #adventure #touring #kayaking #kayaking #paddle #paddling #wildernesssystems #winter #islandlife #outdoors #outdoorlife #paddlemixtape #gopro #howtodoflorida #kayakgram #kayaklyfe #zephyr160 #biscaynebay #atlanticocean #miami #miamilife #bearcut #bridge #keybiscayne #virginiakey
Mar 3 Videos Youtube Kayak Outrigger Stabilizers
Mar 3 Social Instagram Today is going to be an awesome day! Hope everyone has a great Friday! If you need me, Cash me on da lake ° #happyfriday #friday #kayak #kayaking #BeaverLake #Rogers #rogersAR #RogersArkansas #Bentonville #BentonvilleAR #BentonvilleArkansas #NorthwestAR #northwestarkansas #paddlejunkies #perceptionkayaks #wildernesssystemskayaks #wildernesssystems #beautifulday
Mar 3 Social Instagram Solo day paddle on Biscayne Bay #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #paddlemixtape #outdoors #outdoorlife #winter #wildernesssystems #america #atlanticocean #sunscreen #f#gopro #howtodoflorida #j#kayakgram #kayaklyfe #zephyr160 #biscaynebay #miami #miamilife #smile #happiestonthewater
Mar 3 Social Wilderness Systems Fishing Kayaks FB Jeff Little takes you through each step of setting up your retractable anchor system. #Radar135 https://www.youtube.com/watch?v=i4Tbnju7AII
Mar 3 Social Instagram River Ratz Fishing YouTube host and outdoor writer Daniel Reach has a nice article about improving your fishing videos in the Spring 2017 online issue of Kayak Bass Fishing Magazine. They featured a few photos I did of Daniel last fall . Thanks KBF ! www.kayakbassfishing.com #river_ratz_fishing #kayakbassfishingmagazine #texasbassfishing #kayaking #kayakbassfishing #marinersails #marinersailskayakfishingclub #wildernesssystems #bendingbranchespaddles #yakattack #urbanbassfishing #txflyfishingfestival #river.ratz.txyakin#lumixgh3 #hs35100 #hs1235 #imkmark #texaskayakfisherman #kayakbassadventures #kayakbassseries #yakaddicts #fishkats
Mar 3 Social Instagram Kayaking in the sound this afternoon. #avonnc #kayaking #llbean #wildernesssystems #gattoisland #nc #obx
Mar 2 Forums /r/Kayaking Thoughts on a used Wilderness Systems Tarpon 100
Mar 2 Social Instagram Пополнение раздела дисконт : ✔Морской каяк WILDERNESS SYSTEMS FOCUS 150 синего цвета. Лодка участвовала в тест-драйвах на спокойной воде Подробности по ссылке в описании профиля в разделе ДИСКОНТ. #скидка #дисконт #sales #скидки #каяк #морской каяк #kayak #seakayak #морскойкаякинг #sea kayaking #kayaking #kayak
Mar 1 Social Instagram Stud red for this novice fisherwoman! #kayakfishing @carmenskayaks 239-333-7332 #kayakfishingguide #kayaking #fishing #redfish #wildernesssystems #fisherwomen #stud
Mar 1 Social Instagram Fishing sucked due to the wind blowing me all over the lake but it was still better than spending the day in the office. #kayaking #flyfishing #flyfishingjunkie #flyfishingscenery #wildernesssystems #clearlake #flyfishinglouisiana #louisianaflyfishing
Mar 1 Social Wilderness Systems Fishing Kayaks FB 'Kayak Fishing Experience' just won Best Kayak Fishing Film at this year's Reel Paddling Film Festival. If you haven't seen the video check out it now. https://youtu.be/7F5TiFHnV6A Kayak Bass Fishing Reel Paddling Film Festival #wildyfishing
Mar 1 Social Wilderness Systems Fishing Kayaks FB REGISTRATION DEADLINE for 2017 KBF OPEN!
Mar 1 Social Instagram The Zephyr framed between the mangroves on Chicken Key in Biscayne Bay #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #paddlemixtape #outdoors #outdoorlife #winter #wildernesssystems #america #gopro #howtodoflorida #kayaklyfe #kayakgram #zephyr160 #biscaynebay #miami #miamilife #mangroves #islandlife #chickenkey
Mar 1 Social Instagram Having a great time at the first meetup of the year! More will definitely be on the way. Any suggestions of places you would like to go? . . . . . . #canoecountryfl #ccofl #kayaking #paddling #meetup #paddletrip #kayak #kayakmeetup #stpete #tampa #tampabay #clearwater #wildernesssystems #hurricane #cdkayaks
Mar 1 Social Wilderness Systems Fishing Kayaks FB If you're looking to take your tournament skills to the next level then make sure you check out Extreme kayak fishing Inc. Great events and great people!
Feb 28 Social Instagram The Atlantic Ocean doesn't get much calmer than this. Enjoying an early morning paddle off the coast of Virginia Key. Photo credit: @paddlesouthflorida #florida #adventure #touring #kayak #kayaking #paddle #paddling #outdoors #outdoorlife #winter #wildernesssystems #america #southflorida #sunrise #shaka #gopro #howtodoflorida #kayaklyfe #kayakgram #zephyr160 #biscaynebay #atlanticocean #miami #miamilife
Feb 28 Social Instagram He's ready for this years #kayakbassfishing ! . #kayakbassin #wildernesssystems #kayakangler #nativewatercraft #nativeslayerpropel #slayerpropel13 #kayaking #kayakcamping #bassfishing #fishingwithbuddies #allaboutfishingdaily #allaboutthatbassfishing #icatchemall #fish #fishingdaily #fisherman #fishon #fishin #anglerapproved #bassgram #bassmaster #ultralightfishing #bassfishin #bassfishingnation #freshwaterfishing #freshwaterdaily #fishingtrip
Feb 27 Social Instagram Cruzin around Anclote Key #kayak #kayaking #ancloteisland #wildernesssystems #saltlife #fishing
Feb 27 Social Instagram #carterslake #OptOutside #roamwithlions #wildernessculture #wandernorthga #exploregeorgia #georgiaunleased #georgiacreatives #yaklife #kayak #nature #lake #wildernesssystems #tarpon100 #kayaking #optoutsidegeorgia #getoutsidegeorgia #discovering_captures #paddle #womenwhoexplore #herwanderfullife
Feb 27 Social Instagram Monday and daydreaming about about this! #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #outdoors #outdoorlife #winter #wildernesssystems #paddlemixtape #southflorida #gopro #howtodoflorida #kayakgram #kayaklyfe #zephyr160 #biscaynebay #miami #miamilife #daydreaming #monday
Feb 26 Social Instagram That face you make when your fishing for reds and you catch this ° #kayakfishing #kayakangler #largemouthbass #dink #gopro #goprooftheday #gopro4 #goprohero4 #fishing #outdoors #adventure #adventurer #bendingbranches #wildernessculture #tarpon120 #wildernesssystems #costadelmar #costa #skinnywaterculture #thetugisthedrug #like4like #followforfollow #followtrain #kayaking
Feb 26 Social Instagram #sundayfunday #adventurethatislife #At17workout #werner #wildernesssystems #kayaking #kayakingadventures #adventurethatislife #backpacking #biking #whiteblaze #sunrise #gators #gatorbait #swampthing
Feb 26 Social Instagram Awesome photo on the kayak! #flogrown #kayaking #kayakfishing #yakanglers #wildernesssystems #inshorefishing #saltwaterexperience #flatsclass #florida #skinnywaterculture #spiderwire #saltlife #yeeyee
Feb 26 Social Instagram Fighting currents, chasing dolphins and seeing birds! Yaking in Florida is pretty sweet! @wildernesssystems @aquabound @mountainhardwear #kayaking #sprucecreek #water #florida #daytonabeach #beautifulflorida #getoutside #havefun #freshair #breathein #itsgreattobealive
Feb 26 Social Instagram Can't wait to get back on the water. #wildernesssystems #kayak #paddling #kayaking
Feb 26 Social Instagram It was an awesome day on the water! #kayak #kayaking #kayakingadventures #gulfcoast #naples #florida #saltlife #oceankayak #wildernesssystems #intothewild #explore #exploremore #outdoors #outdoorlife #getoutside #adventure #adventuretime #nature #natureonly #natureporn #naturegram #naturephotography #nature_brilliance #naturelovers #naturelover #nature_perfection #instanature #instanaturelover #sundayfunday #floridalife
Feb 26 Social Instagram Heading out this morning #wildyfishing #wildernesssystems #atak120 #bbpaddles #kayakfishing #kayaking
Feb 25 Social Instagram Morgantown, WV from the mighty Monongahela at the mouth of Decker's Creek. #monongahelariver #wildwonderful #wildernesssystems #kayakingadventures #kayaking
Feb 25 Social Instagram At home in the mangroves. I'm sure @wildernesssystems didn't design the Zephyr to be exploring the narrow mangrove channels but it's maneuverability is great for the tight spaces #FLATkayak #adventure #touring #kayak #kayaking #miami #southflorida #paddle #paddling #paddlemixtape #outdoors #outdoorlife #winter #wildernesssystems #america #gopro #howtodoflorida #kayakgram #kayaklyfe #zephyr160 #biscaynebay #nofilter #miamilife #mangroves #shaka
Feb 25 Social Instagram That was short lived. Thanks for the tease, Michigan. #snow #snowingagain #stop #wildernesssystems #aspire105 #watersports #springiscoming #kayak #kayaking #paddle #springfever #pontiacvibe #vibe #lightroomapp
Feb 25 Social Instagram Celebrating each other with a maiden voyage out on Lake Lytle! ⛰☀️°°‍♀️ #kayaking #kayak #oregon #nature #getfit #wildernesssystems #blueskies
Feb 25 Social Instagram Transportation to Anclote Key @joseph_stover #wildernesssystems #Yamaha #kayak #kayaking #camping #waverunner #saltlife #beach #islandlife #adventure
Feb 24 Social Instagram Looking forward to this years fishing! . . #wildernesssystems #kayakbassin #kayakfishing #kayakangler #Radar115 #WildernessSystemsRadar115 #familyfun #kayaking #kayakcamping #bassfishing #fishingwithbuddies #allaboutfishingdaily #allaboutthatbassfishing #icatchemall #fish #fishingdaily #fisherman #fishon #fishin #anglerapproved #bassgram #bassmaster #ultralightfishing #bassfishin #bassfishingnation #freshwaterfishing #freshwaterdaily #fishingtrip
Feb 24 Social Instagram First day in my @wildernesssystems Tarpon 100, he's in his #ride115x and he caught his first kayak #bass ! #kayak #kayaking #kayakfishing #wildernesssystems #tarpon #ride
Feb 24 Social Instagram #kayak #wildernesssystems #tarpon120 #woodsreservoir #sunset #paddle #getoutside #greettheoutdoors #roadlesstraveled #face_of_the_earth #water_captures #waterscape #water #watercolor #watercaptures #neverstopexploring #boat #boatlife #kayakfishing #kayaking
Feb 24 Social Instagram First time out in the kayak this year (Feb 22nd). A long awaited reunion. #kayak #kayaking #paddling #water #imissedthis #comeonwarmweather #kalamazooriver #twoheartedale #iphone7plus #nature #watersports #sunshine #wildernesssystems #aspire105 #bellsbrewery #bellsbeer #twohearted
Feb 24 Forums /r/Kayaking Help me narrow a kayak down, please!
Feb 24 Social Instagram Tbt... Priest Lake, ID. Kalispell Island!!! Paddle in camping!!! #wildernesssystems #kayaking #gopro #camping #fireside #paddle #sand #beachlife #tbt #ipadventures #getoutside
Feb 24 Social Instagram Tbt...can't wait to get back to Steamboat Rock State Park in Washington State!!! #hiking #beach #tbt#ipadventures #adventure #overland #adventuretrailer #kayaking #wildernesssystems #gofsr #gopro #xterra #
Feb 23 Social Instagram #kayaking #paddling #fishing #trout #kayakfishing #speckledtrout #wildernesssystems #tarpon #choctawhatcheebay #Florida #saltlife
Feb 23 Social Instagram Awesome photo while on the @wildyfishing ATAK 140. This kayak has it all. #zman #wildernesssystems #kayakfishing #donray #shieldsofstrength #kayaking #inshorefishing #yakangler #spiderwire #stcroix #flatsclass #saltwaterexperience #showyourmogan
Feb 23 Social Instagram A throwback to summer paddling and an excited pup! . #pug #kayaking #pets #pugsofinstagram #summerfun #megatongue #tbt #wildernesssystems #outwardhound
Feb 22 Social Wilderness Systems Fishing Kayaks FB Take 5 minutes and be a part of driving the R & D process for our custom Wilderness Systems accessories! http://survey.constantcontact.com/survey/a07eduvnt9xizg1z11n/start
Feb 22 Social Instagram @kla.rose_ with her first ever bass from a kayak! #kayak_fishing_Ontario #bassfishing #bass #kayaking #kayakfishing #yakfishing #supfishing #fishing #wildernesssystems #canada
Feb 22 Social Instagram #ichetuckneeriver #ichetuckneespringsstatepark #fortwhite #florida #kayaking #tarpon120 #wildernesssystems #river #water #crystalclear #springs #wander #travel #fun #outside #outdoors #getoutside #greatoutdoors #blueskies #sunshine #beautiful @wildernesssystems
Feb 22 Social Instagram Added two more to the fleet today! Radar 115 from #wildernesssystems Kayaks! . . #kayakbassin #kayakfishing #kayakangler #Radar115 WildernessSystemsRadar115 #familyfun #kayaking #kayakcamping #bassfishing #fishingwithbuddies #allaboutfishingdaily #allaboutthatbassfishing #icatchemall #fish #fishingdaily #fisherman #fishon #fishin #anglerapproved #bassgram #bassmaster #ultralightfishing #bassfishin #bassfishingnation #freshwaterfishing #freshwaterdaily #fishingtrip
Feb 21 Social Instagram Confluence of the Cheat River and the mighty Monongahela at Point Marion, PA. #monongahelariver #kayakingadventures #kayaking #wildernesssystems #kayakgram_feature
Feb 20 Social Instagram Group 1 of 2 launching this morning! Big groups heading out this week, and lots of #sunshine for them right now! #safepaddling everyone °°#itsbetterinthebahamas #kayaking #kayaktrip #kayakgram_feature #goexplore @sturgischarter @sturgischarter.school #sturgis2017 #neckykayaks #wildernesssystems @neckykayaks
Feb 20 Social Instagram Happy Monday #lovefl #kayaking #kayakingadventures° #wildernesssystems #tarpon140kayak #werner #optoutside #outdoors #gatorbait #chaconation #camping #mountainscalling #At17workout #adventurethatislife #mondays #c
Feb 20 Social Instagram Well that happened! Summer can't get here fast enough. ☀️°°‍♀️°#kayak #kayaking #wildernesssystems #oregon #getfit #nature #pamlico135t
Feb 20 Social Instagram Happy President's Day! Enjoying the day off the best way I know how #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #winter #wildernesssystems #outdoors #outdoorlife #paddlemixtape #southflorida #gopro #howtodoflorida #kayakgram #kayaklyfe #zephyr160 #biscaynebay #miami #miamilife #presidentsday #USA #america #dayoff
Feb 20 Social Instagram #laparguera #kayaking #parguerakayaking #epic #epicpaddles #wildernesssystems #keen #sunnyday #clouds #fun #gopro #withgoodfriends #redkayak #tarpon160 #funday
Feb 20 Social Instagram ... this crazy weather has me thinking crazy #notnowbutsoon #washoutthekayak in case it stays warm #springcleaning #kayaking #wildernesssystems #kayaklife #justincase #outsideisfree #planning #dreamsdocometrue
Feb 20 Social Instagram What the water sees. #nature #lakes #wernerpaddles #wildernesssystems #florida #springs #getoutside
Feb 19 Social Instagram #kayaking in February #wildernesssystems #tarpon100 #gopro
Feb 19 Social Instagram Water is the essence of wetness. 'No direction but to follow what you know,  No direction but a faith in her decision,  No direction but to never fight her flow,  No direction but to trust the final destination.  You're a stranger til she whispers you can stay.  You're a stranger til she whispers that your journey's over.  Weigh your worth before her majesty, the Verde River.' - Puscifer #asrt #florida #wernerpaddles #wildernesssystems #kayak #yellow #red #blue #seattle
Feb 19 Social Instagram Have not had a calm day in a long time. Which not a bad thing ° #seakayaking #seakayak #kayaking #kajak #kayak #capetownmag #lovecapetown #capetown @sawyeroars #kayakingislove @wildernesssystems
Feb 19 Social Instagram A few double crested cormorants hanging out on the channel marker #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #winter #wildernesssystems #outdoors #outdoorlife #paddlemixtape #southflorida #gopro #howtodoflorida #kayaklyfe #kayaklyfe #zephyr160 #biscaynebay #miami #miamilife #manateezone
Feb 18 Social Instagram Spontaneous kayak excursion on the Maumee. Who else is ready for summer? @aagale2 #kayaking #wildernesssystems #toledometroparks #middlegrounds #ohioweather
Feb 18 Social Instagram What adventures are you planning? Let's get out there!!! #beach #hiking #ipadventures #love #kayaking #optoutside #overland #lake #gofsr #wildernesssystems
Feb 18 Social Instagram Chetco River sup and kayak combo #wildernesssystems #sup #xcelwetsuits #perception
Feb 18 Social Instagram Humans.. it's what's for dinner!! #whatareyoudoingthisweekend #wildernesssystems #tarpon140kayak #manatees #optoutside #kayakingadventures #kayaking #ocean #gators #justdoit #At17workout #mountainscalling #camping #chaconation #biking #backpacking
Feb 18 Social Instagram #kayaking #amistadreservoir #optoutside #wildernesssystems
Feb 17 Social Instagram Fireside kayaks!!! Find your adventure!!! #camping #paddle #kayaking #fire #campfire #love #ipadventures #beach #hiking #wildernesssystems #gofsr
Feb 17 Forums /r/Kayaking Maiden voyage on my first kayak - wilderness systems zephyr 160 - taken summer 2015.
Feb 17 Social Instagram The Tarpon family continually proves a fan favorite here at the shop, we've had a slew of people picking one up in various sizes this week. It's a great compromise of comfort, speed, stability, and versatility. Who out there has some good experiences in one? . . . . . . . . . #canoecountryfl #ccofl #wilderness #wildernesssystems #tarpon #wildernesstarpon #paddling #kayak #kayaking #kayakfishing #paddlefishing #florida #stpete #tampa #clearwater #tampabay #sarasota
Feb 17 Social Instagram #camping #HondaElement #renogysolar #kayaking #wildernesssystems #iceholecoolers #Amistad #solarpower #optoutside #renogyadventures #offgrid @renogysolar #inmyelement
Feb 16 Social Instagram Thinking about a spring Priest Lake, ID run!!! Nothing like having the Lake to yourself!!! Get out there!!! #tbt #getoutside #getoutthere #ipadventures #paddle #loveofmylife #kayaking #spring #snow #camping #hiking #wildernesssystems
Feb 16 Social Instagram Humbled and honored to join the @fishingtackleunlimited prostaff representing @wildyfishing /Wilderness Systems Kayaks. #ftu #tarpon130x #fishingtackleunlimited #gear #tackle #apparel #rod #reels #shimano #simms #yeti #13fishing #columbia #shark #bass #dorado #marlin #gar #huge #kayaks #paddles #sup
Feb 16 Social Instagram Another @WildernessSystems #Atak110 is heading for the water. Looking forward to the beautiful weather this weekend. #HOOK1 #kayak #Kayaking #Paddle
Feb 16 Social Instagram Kayak Photography. #kayak #kayakfishing #kayaking #kayaks #fishing #canon #canon1d #canon100400 #river #lake #wildernesssystems #peddlekayak #brisbane #queensland #australia #summer #sun2sea #sunshirt #50+ #cancercouncil #sunprotection #slipslopslap
Feb 15 Social Instagram Can't wait for Summer! Lake Päijänne, Jyväskylä, Finland #kayaking #wildernesssystems #capehorn17 #päijänne #freedom#outdoors #paddling #placidity
Feb 15 Social Instagram Can't wait for Summer #2, Päijänne National Park, Finland #kayaking #wildernesssystems #capehorn17 #päijännenationalpark #freedom#outdoors #paddling #seakayak
Feb 15 Social Instagram Trying out the #helixmd motor drive by @torqeedo from @wildyfishing in the brand new #radar115 #wildernesssystems #wildernesssystemskayaks #radarkayak #handsfree #kayaking #shiptoshoremarine Very, very impressive. I can't wait for the #peddledrive to come.
Feb 15 Social Wilderness Systems Fishing Kayaks FB Never a dull moment with this crew! Chad Hoover Randy Howell, 2014 Bassmaster Classic Champion Mike Iaconelli https://youtu.be/AI0Eza_dKLM
Feb 15 Social Instagram Chain Pickerel on mini Banger Fly @ Daingerfield SP TX. #onthefly #txflyfishingfestival #texasstateparks #daingerfieldstatepark #findyourwater #tforods #rioflylines #repyourwater #fortworthflyfishers #orvissouthlake #flyfishingtexas #lamsonwaterworks #wildernesssystems #wernerpaddles #thetugisthedrug #lifesbetteroutside #lumixgh3 #flyfishingjunkie #pickerel #fishporn #flytying #imkmark
Feb 15 News Kayak Angler Magazine Two kayak Fishing Television series to watch out for…
Feb 14 Social Instagram Spent a great weekend with my valentine and a few crazy friends kayaking , fly fishing, and enjoying the great outdoors at Daingerfield State Park TX. Thanks LM for doing our photo ! #daingerfieldstatepark #texasstateparks #lifesbetteroutside #wildernesssystems #jacksonkayak #wernerpaddles #tforods #waterworkslamson #texasflyfishing #txflyfishingfestival #runningcreek #dutchoven #rabidfly #paddletexas #lumix #chainpickerel #wildacrebrewing #exofficio #rahrbrewery #rioflylines #imkmark
Feb 13 Social Instagram Beach it!!! Looking for a base camp!!! #climbing #hiking #kayaking #tbt #wildernesssystems #love #ipadventures #sandytoes
Feb 13 Social Instagram Check out this pig!! If you get a chance go check out @fish_georgia. He's running a Wilderness Systems Radar!@AppLetstag #kayakfishing #fishing #bassfishing #bass #fish #kayaking #gopro #catchandrelease #largemouthbass #yakattack #angler #yaklife #bigbass #hobie #kayaklife #freshwater #kayaks #abugarcia #lunker #freshwaterfishing #kayak #nativeamerican
Feb 13 Social Instagram LETS GO FISHIN'! @yakangler67 @siyakfishing #siyakfishing #screwylewylures #wildernesssystems #wildyfishing #bendingbranches #abugarcia #sixgillfishing #yaktribe #yakattack #kayak #kayaking #kayakfishing #feelfree #lowrance #powerteamlures #chevy #johnjonesautogroup
Feb 13 Social Instagram $2.50 rod leashes for kayak fishing. Leash it or lose it! Will probably change out the clip for a stronger stainless steel one though. #kayakbassin #kayak #kayakfishing #fishing #kayakangler #leash #riverfishing #riverbassin #make #rodleash #fishingrod #lewsreels #powellrods #bassfishing #kayaking #paddle #fish #wildernesssystems #jacksonkayak
Feb 12 Social Instagram Chilling on the flats! #flatsfishing #kayakfishing #kayaking #wildernesssystems #tarpon120 #tag #followtrain #follow #followme #like4like #fun #selfie #outdoors #fishing #fishinglife #adventure #travel #goprophotography #goproeverything #goprohero4 #photooftheday #goprooftheday #instagood #istalike #me #likeforlike
Feb 12 Social Instagram Sarah's so excited to go kayaking today! #kayaking #pilotmountain #subaruoutback #malonetrailers #pilotmountainstatepark #wildernesssystems #pungo120 #tsunami125 #febuaryinnc #subaru
Feb 12 Social Instagram Kayaking on the Yadkin River today. #kayaking #pilotmountain #pilotmountainstatepark #yadkinriver #yadkinriverkeeper #wildernesssystems #pungo120
Feb 11 Social Instagram Who else is ready to get back on the Water? #siyakfishing #yaktribe #kayaking #kayakfishing #kayakbassfishing #wildernesssystems #wildyfishing @orvislouisville
Feb 11 Social Instagram Base camp!!! Get out there!!! #gofsr #pnw #wildernesssystems #kayaking #ipadventures #optoutside #getoutthere #freespiritrecreation #camping
Feb 10 Videos Youtube Bull Redfish - Marsh Redfish on Artificial Lure Video - Personal Best Kayak Redfish
Feb 10 Social Instagram #tbt to last year's Okee trip. With a federal permit we spent 3 days kayaking and camping on islands & wooden platforms in the swamp. Great times in the wild, unplugging from the world. °° The Okefenokee Swamp is a shallow, 438,000-acre, peat-filled wetland straddling the Georgia–Florida line in the United States. A majority of the swamp is protected by the Okefenokee National Wildlife Refuge and the Okefenokee Wilderness. The Okee is the largest 'blackwater' swamp in North America. . #okefenokee #okefenokeeswamp #wildernesssystems #sunset #kayaking #igersjax #roamflorida #unplugged #blackcreekoutfitters #gopro #gpotd
Feb 10 Social Instagram Follow me!!! #ipadventures #camping #kayaking #wildernesssystems #pnw #gofsr
Feb 9 Social Instagram Throwback Thursday. Fish thieving Osprey dive bombing my catch! Between these guys and Zipper the surly dolphin...they spoil my fishing. #saltlife #kayak #kayaking #kayakfishing #paddle #fishing #optoutside #getoutside #getoutdoors @wildernesssystems @seatosummitgear @sawyerproducts @advancedelements #exploremore #explore #florida #adventure #fun #sun @camelbak @merrelloutside #testedtough @columbia1938 @kershawknives #birds #birdsofprey #birdsofinstagram
Feb 9 Social Instagram Where did my Gurgler go ? #imkmark #templeforkoutfitters #bassonthefly #txflyfishingfestival #orvissouthlake #fortworthflyfishers #flyrodbass #flytying #flyfishingjunky #brazosriver #wildernesssystems #wernerpaddles #lumixgh3 #thetugisthedrug #lifebetteroutside #flyrod #lamsonwaterworks #findyourwater #repyourwater #keepemwet #flyfishingtexas
Feb 8 Social Instagram Not a bad spot today for lunch/nap. #bedrocksandals #getoutthere #kayakflorida #santaferiver #kayakgear #kayaking #paddlingmixtape #rivershoes #wildernesssystems #goalzero #goprosession
Feb 8 Social Instagram Underwater shot at Ginnie Springs. #kayaking #santaferiver #kayakflorida #getoutthere #nofilter #kayakroll #flsprings #wildernesssystems
Feb 8 Social Instagram #wildernesssystems #columbia #camping #kayaking #kayaklife #kayakcamping
Feb 8 Social Instagram Kayak fishing the Colorado river during monsoon season⛈°⛈rod tips down boys. #mightycoloradoriver, #squawlake, #senetorswash, #coloradoriverkayaking, #coloradoriver, #yumaarizona, #monsoonseason, #kayaking, #kayakfishing, #wildernesssystems, #wildernesskayaksystems, #kayakfishingphotos, #kayakingintherain.
Feb 8 Social Instagram This is where I want to be!!! ☀ Summer 2015 . #fishing #fishingislife #summer #bassfishing #largemouth #smallmouth #bassthumb #lunker #river #kayak #kayaking #canoe #kayakfishing #musky #wildernesssystems #rapids #fish #perch #fishingcanada #girlsfishtoo #girlswhofish #girlsthatfish #bestoftheday #photography #gopro #kawarthas
Feb 7 Social Instagram The Wilderness System ATAK 140 front and center for tonight's seminar. Thank You GBFA for the hospitality and letting me sharing my kayak fishing passion! #wildernesssystems #wernerpaddles #localfishingclub #1stlandingguide #kayakfishing #yakattack
Feb 7 Social Instagram Another successful Saturday! 15 crabs and good times on the water with friends. #budweisercrabbincrew #gopro #wildernesssystems #wildyfishing #tarpon160i #wernerpaddles #nrs #lowrance #promar #whowantstogo?!
Feb 7 Press misc. Paddlesports Retailer Open For Buyer And Vendor Registration - SGB Media (press release) (subscription) (blog)
Feb 7 News unsponsored Paddlesports Retailer – Registration Now Live
Feb 6 Social Instagram When it looks like your paddling in a painting °Plockton #kayaking #kayak #paddling #outdoorlife #outdoors #plockton #wilderness #wildernesskayaks #loch #scotland #landscape #landscapephotography #wildernesssystems #skye
Feb 6 Forums YakAngler Wilderness Helix PD, Buy in March or wait?
Feb 5 Forums /r/kayakfishing Which kayak?
Feb 5 Social Instagram The early summer of 2009 was the back end of a decade-long drought in southern Australia, and the Murray River took the brunt. The country's largest river by volume runs 2500km from the snowy mountains to the Southern Ocean and all but 100km at the top was without current. Nevertheless, those 79 days in Nala the Kayak gave me a love and respect for rivers that will never leave, as well as providing the second non-motorised 1000-mile + journey of #expedition1000 #adventure #murrayriver #sayyesmore @yesisadoingword #travel #australia #victoria #newsouthwales #kayaking #paddling #journey @buff_uk @powertraveller @wildernesssystems #tempest
Feb 5 Social Instagram Can't sleep! Excited about Kayak Fishing with hubby tomorrow! Maybe that #canepole he found will grab a big one! ° . . #Obsessed #hubby #myman #mylove #beard #Heath #calicorock #arkansas #arkansas_life #arkansaslife #thenaturalstate #explorearkansas #outinarkansas #kayaklife #kayak #kayaking #kayakfishing #redneckway #wildernesssystems #perceptionkayaks #bendingbranches #paddleon #paddle #1st #photooftheday #like #likeforlike #like4like #getoutside
Feb 5 Social Instagram Pistol took a spill over the side of the Kayak yesterday in the 40 degree weather °°°°❄°°❄°°.... It was after I got her back up in the kayak and dried off that she must have decided it was a better idea to just sit on the nice dry pine shavings rather than stand up on the edge and hang over the side ° . . #lifelessons #learnedthehardway #sillygirl #cold #overboard #splash #oops #winter #dogsofinstagram 1/2 #americanbulldog #half #bostonterrier #muttsofinstagram #dog #kayakingdogs #kayaking #kayaklife #wildernesssystems #paddleon #adventure #swimming #Pistol #WhiteRiver #arkansas #arkmophs #thenaturalstate #3rd #photooftheday #outinarkansas #getoutside
Feb 5 Social Instagram “Every Man Dies, Not Every Man Really Lives.' William Wallace #Kayaking #KayakFishing #WildernessSystems #ColumbiaPFG #CharlestonAngler
Feb 5 Social Instagram Tip of the day: Foam practice golf balls for scupper plugs for Kayaks! They are cheap but work as good as the expensive good quality scupper plugs! I wish I had known this a long time ago! . . . #duh #whydidntithinkofthat #kayaks #kayak #kayaklife #kayaking #gosomewhere #explore #water #paddle #paddleon #goodidea #2nd #photooftheday #golfballs #plugged #WhiteRiver #calicorock #arkansas #river #perceptionkayaks #jacksonkayaks #wildernesssystems #hobie #daggerkayaks #photo #lifehacks #lifehack #yellow #scuppers
Feb 4 Social Instagram Morgantown pool of the Monongahela River at the I-68 Uffington bridge. White paint is 30' making it about 110' from roadbed to water. #monongahelariver #kayakingadventures #kayaking#wildwonderful #wildernesssystems
Feb 3 Videos Youtube How to load a kayak on/off a car. Wilderness systems atak 140
Feb 3 Social Instagram It’s kayaking time. With the old St. Petersburg Pier in the background. #kayaking #kayakingadventures #thepier #stpetersburgpier #stpetersburgfl #northshorebeach #wildernesssystems
Feb 3 Social Instagram We have been updating our new webpages this week and we should have them ready next week. Then we can start dreaming about summer evenings like this. #naturavivafinland #kayaking #melonta #melontaretki #Helsinki #Vuosaari #sunset #auringonlasku #myhelsinki #helsinkisecret #dayinhelsinki #balticsea #wildernesssystems #discoveringfinland #retkipaikka #suomiretki
Feb 3 Social Instagram We will be offering free kayak demos this Saturday, since the weather looks to be ideal. If there is a particular boat you have been eyeing, but wanted to paddle before jumping in, or interested in the sport and would like to get your feet wet, give us a call today and let us know you'll be coming out. If there is a particular boat or board, let us know and we'll be sure to get it out there for you. Demos start at 9:30am. . . . . . . . . #canoecountryfl #ccofl #wilderness #wildernesssystems #perception #kayaks #paddleboards #sup #canoe #demo #kayakdemo #freedemo #saturday #weekend #stpete #tampa #florida #clearwater
Feb 2 Social Instagram Chain Pickerel on Seaducer Fly. Looking forward to catching a few of these next weekend.#flyfishing #flyfishingtexas #thetugisthedrug #chainpickerel #orvissouthlake #rioflylines #tforods #repyourwater #texasstateparks #daingerfieldstatepark #onthefly #seaducerfly #txflyfishingfestival #fortworthflyfishers #flyfishingjunkie #wildernesssystems #kayaking #flyrods #toothyfish #canonusa #redingtongear #waterworkslamson #fishporn #imkmark
Feb 1 Social Instagram Columbia, MO is a great place, making it easy to #shoplocal and #adventurelocal. Gear up at Alpine Shop and get on the water at Finger Lakes. #kayaking #floating #kayak #paddle #outdoorlife #jacksonkayak #wildernesssystems #rivers #lakes #missouri #columbia #missouristateparks #fingerlakes
Feb 1 Social Wilderness Systems Fishing Kayaks FB Check out the Wilderness Systems blog to get tips and tricks from our pros, like this one from ACA kayak instructor and licensed fishing guide Juan Veruete. http://www.wildernesssystems.com/us/experience/team-blog/297/post/gear-layout-tip-netting-more-fish
Feb 1 Social Instagram Always on full alert ° #kayakingdogs #dogsofinstagram #1/2 #americanbulldog #half #bostonterrier #calicorock #arkansas #arkmophs #wonderfularkansas #arkansaslife #whiteriver #getoutside #outinarkansas #outintheozarks #paddleon #kayaklife #kayaking #paddle #wildernesssystems #water #dogs #thankyou #OMTC #winter #photo #capture #kayak #gosomewhere #kayakingadventures
Feb 1 Social Instagram Last night's sunset with smoke from the forest fire mixed in. It's so much more fun sitting here looking at pictures of it than it was breathing it out there last night °°° #ozarknationalforest #fire #sunset #river #sunsets #smoke #arkansas #wonderfularkansas #arkmophs #nature #whiteriver #explorearkansas #thenaturalstate #outinarkansas #kayaking #paddleon #perceptionkayaks #wildernesssystems #kayaklife #paddle #photography #2nd #photooftheday #reflection #photo #capture #gosomewhere #kayakingadventures
Jan 30 Social Instagram Perfect day for a paddle ☀️°° - #kayaking #paddling #goosecreek #goosecreekstatepark #optoutside #outdoors #nature #nc #ncstateparks #washingtonnc #wildernesssystems #tarpon120 #yaklife
Jan 30 Social Instagram In case anyone was wondering, I miss my kayak. Is it spring yet? #kayaking #ADK #churchofthedoublebladedpaddle #Adirondacks #Tsunami #WildernessSystems
Jan 30 Social Wilderness Systems Fishing Kayaks FB Wilderness Systems Fishing Kayaks updated their cover photo.
Jan 30 Social Instagram Daydreaming on a Monday #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #miami #southflorida #biscaynebay #outdoors #outdoorlife #getoutside #january #winter #endlesssummer #gopro #wildernesssystems #zephyr160
Jan 30 Social Instagram Yesterday fun day #kayaking #puertorico #guanica #gulligansisland #tarpon160 #gopro #hero4 #keen #epicpaddles #sea #wildernesssystems #sundayfunday #relaxation
Jan 30 Social Instagram #kayak #kayaking #paddle #adventure #outdoors #river #savannahriver #augustaga #wildernesssystems
Jan 30 Social Instagram 'We sea kayaked the Green River for 150 miles. Low water dried up the clear streams we were sourcing and it took hours to drink something that didn't resemble chocolate milk. 10/10 would do it again.' ° @gabesimages - @wildernesssystems @canyonlandsnps - #adventurekayak #canyonlandsnationalpark #kayaking #paddleforever
Jan 29 Social Instagram Always a good day when you can be on the ocean! #crabbing #bodegabay #doranbeach #crabfest #atleastididntcomehomeemptyhanded #nrs #wernerpaddles #promar #donttreadonfreedom #saltarmor #gopro #sorenow #wildernesssystems
Jan 29 Social Instagram No fish in the boat today but it's always nice getting out there, despite the cold . This time last year this lake was frozen. #fishing #bassfishing #bass #winter #winterfishing #kayak #kayaking #kayakfishing #kayakangler #nature #sunset #freshwater #lakelife #picoftheday #ilovefishing #catchandrelease #wilderness #wildernesssystems #thegreatoutdoors #fish #sky #clouds
Jan 29 Social Instagram So happy to have a wife who comes along on my adventures. Life is better with @lorihoep #kayakflorida #flsprings #kayakadventures #getoutthere #itchetucknee #wernerpaddles #wildernesssystems #liquidlogic #paddlingmixtape
Jan 28 Social Instagram A moment of peace. . . . . . . . . . . . @wildernesssystems #kayak #kayaking #outdoors #nature #liveauthentic #keepitwild #thegreatoutdoors #takemoreadventures #findyourselfoutside
Jan 28 Social Instagram Great seatrout caught in key largo, Florida!!! #florida #usa #bitebooster #catchoftheday #fish #fishing #nicecatch #seatrout #trout #wow #visitflorida #lure #new #instadaily #kayak #wildernesssystems #kayaking #kayakfishing #keylargo #flakeys
Jan 28 Social Kayak Angler Magazine FB Have you paddled any of the newest Wilderness Systems Fishing Kayaks? Let us know what you think! #kayakfishing #kayakangler #wildernesssystems #paddleforever
Jan 28 Social Instagram Hooked up on a winter time speck! #fish #kayakfishing #kayaking #wildernesssystems #tarpon120 #speckledtrout #catchandrelease #nature #outdoors #trout #saltlife #gopro #goprohero4 #beahero #goprooftheday #fishinglife #tightlines #pennreels #hookedup #fishon #river #fisherman #saltwaterfishing #like #like4like #followtrain
Jan 28 Social Wilderness Systems Kayaks FB Eastern US Sales Team taking off on a three day trip to Cumberland Island. Do what you love, love what you do! #wildernesssystems #atpaddles #mustbenice
Jan 26 Social Instagram #firstpaddleoftheyear . Winter is just another #paddlingseason #plumpoint New Windsor NY. This 'nice' weather was just too tempting. Took the @wildernesssystems Zephyr15.5 out for a stroll. #paddlinglife #kayaking #paddling #nooffseason #mountainhardwear #goretex #sealsprayskirt #wernerpaddles #kokatat #salamanderthrowrope #crktedc #crkt , #milspecplus #seatosummit #drybags
Jan 26 Forums NorCal Kayak Anglers Re: 2016 AOTY/DOTY Awards Ceremony
Jan 26 Social Instagram #tbt I'm really not sleeping. Dare you to pull my tail °#optoutside #outdoors #gatorbait #kayaking #kayakingadventures #adventurethatislife #rivers #chaconation #backpacking #wildlife #wildernesssystems #justdoit #noswimming #lovefl #floutdoors
Jan 25 Social Instagram My #wcw she's my world! More #kayaking #adventures to come!! #fishing #bassfishing #kayakfishing #kayakbassfishing #flyfishing #hfe #yakattack #yakaddicts #yaktribe #wildy #wildyfishing #wildernesssystems #rawjuiceoutdoors #rawjuicefishing #oneidalake #iloveny #cny #beardnation #beardgang #beardfishing #largemouth #smallmouth #whatgetsyououtdoors #xcitebaits #kayakanglers #catchandrelease
Jan 25 Social Instagram Lunch break at Castle Dome Landing, on the Colorado river⛰☀️#coloradoriver, #lowercoloradoriver, #yuma, #yumaarizona, #kayakfishing, #kayaking, #wildernesssystems, #imperialcounty, #lakemartinez.
Jan 25 Social Instagram Mmmmm.... Who's that sexy paddler? Oh wait, that's my Kevin. :) #cypresstree #cypresshouse #lakemartin #thatlacommunity #breauxbridge #louisiana #explorelouisiana #explore #wander #wanderlust #waterlust #adventureisoutthere #adventurer #paddling #kayaking #spanishmoss #swamplands #bayou #wherethewildthingsare #goprooftheday #goproawards #goprohero4 #thegreatoutdoors #goproeverything #intothewild #gopro #wildernesssystems
Jan 25 Social Instagram Still shot from today. I will never claim to be an expert at photography, nor do I try to be, I just hope for the best! I will say that it is nice to have a camera doing the work for you so you can enjoy what you are doing instead of trying to get one shot! #gopro #wildernesssystems #kayakflorida #kayakadventures #lumpywaters #nrs #getoutthere #fernandinabeach #kayak #wernerpaddles #kayaking #staysaltyflorida
Jan 24 Social Instagram Mighty cypress and tupelo trees towering above us. #cypresstree #cypresshouse #lakemartin #thatlacommunity #breauxbridge #louisiana #explorelouisiana #explore #wander #wanderlust #waterlust #adventureisoutthere #adventurer #paddling #kayaking #spanishmoss #swamplands #bayou #wherethewildthingsare #goprooftheday #goproawards #goprohero4 #thegreatoutdoors #goproeverything #intothewild #gopro #wildernesssystems
Jan 24 Press misc. 1 Wilderness Systems Zephyr 155 Pro - CANOE & KAYAK
Jan 23 Social Instagram Take me back to summer!!!! #kayaking #summer #onthewater #nature #optoutside #naturelovers #kayakingadventures #wildernesssystems #outdooradventures #tbt
Jan 23 Social Instagram #kayaking #indianlake #wildernesssystems #ohio #ohio
Jan 23 Social Instagram Took Kevin and Dr. Medina kayaking at Lake Martin today! #cypresstree #cypresshouse #lakemartin #thatlacommunity #breauxbridge #louisiana #explorelouisiana #explore #wander #wanderlust #waterlust #adventureisoutthere #adventurer #paddling #kayaking #spanishmoss #swamplands #bayou #wherethewildthingsare #goprooftheday #goproawards #goprohero4 #thegreatoutdoors #goproeverything #intothewild #gopro #wildernesssystems
Jan 23 Social Instagram Swooning over Spanish moss. #cypresstree #cypresshouse #lakemartin #thatlacommunity #breauxbridge #louisiana #explorelouisiana #explore #wander #wanderlust #waterlust #adventureisoutthere #adventurer #paddling #kayaking #spanishmoss #swamplands #bayou #wherethewildthingsare #goprooftheday #goproawards #goprohero4 #thegreatoutdoors #goproeverything #intothewild #gopro #wildernesssystems
Jan 23 Social Instagram We do not suggest going paddling today, the wind and waves are pretty treacherous. But when it does calm down, those looking to go offshore in a kayak should check out the Wilderness Thresher. This kayak can best be described as a beefed up Tarpon, plenty of speed to get out there, with extra stability to handle swells where it thrives. A great option for both divers and fisherman alike. . . . . . . . . . #canoecountryfl #ccofl #kayak #kayaking #paddling #wilderness #wildernesssystems #thresher #wildernessthresher #diving #fishing #kayakfishing #florida #stpete #tampa #clearwater #offshore #offshorefishing #spearfishing
Jan 22 Social Instagram Got Jeff out on the water this beautiful January day. #kayak #kayaking #kayakadventure #kayakadventurer #kayaklove #adventure #paddle #outdoors #getoutdoors #thegreatoutdoors #oldtownkayaks #outdoorlife #canoe #wildernesssystems
Jan 22 Social Instagram Went out and caught about 10-12 white bass on the yak today! #hookedandtagged #teamhookedandtagged #bassing #Whitebass #Yaking #Kayaking. #Kayakfishing #wildernesssystems #Wildernesskayaks #kayakbassfishing #KBFTN
Jan 22 News Angling International Kayak fishing industry unifies into a council and endorses Paddlesports Retailer as its official trade show
Jan 22 Social Instagram I love my #wildernesssystems kayak, but am looking for something a little bit smaller, faster, and more agile for river, lake, and/or creek kayaking. Any suggestions? #lifeoutloud #outbound #artistfound #wanderlust #nature #naturephotography #outdoors #main_vision #naturegram #instagram #earthpix #visualsoflife #visualsofearth #roamtheplanet #natgeo #natgeotravel #travelphotography #travel #earthimagined #untoldvisuals #topexplorers #earthimagined #outdoorsdventurephotos #natgeoit #kayak. #kayaking #kayakadventures #freedominwilderness #visitwilm!
Jan 22 Social Instagram Hit my spot yesterday on the #kayak with my lil man ruger. Started at 8 and got back in the truck at 5. Long fun day in the #outdoors. @wildernesssystems @wernerpaddles #redheeler #kayaking #getoutside #texas
Jan 22 Social Instagram Proper beaut of a day :) #riverdart #totnes #devon #kayaking #gopro #wildernesssystems
Jan 22 Social Instagram My hobbies are getting too expensive #kayaking #mtg #bikes #books #hobbies #mountainbike #runner #shelfie #willrunforbling #wildernesssystems #magicthegathering #bookstagram #deathnote #oracleofdelphi #trekbikes #robopocalypse #boardgames #nike
Jan 21 Social Instagram Go check these guys out!! They are puttin on a pretty bad ass yak tourny this year. Repost from @kayakfishingidaho using @RepostRegramApp - We want to welcome Idaho River Sports to the KFI Family as the AOY Title Sponsor. They have Generously donated a Wilderness Systems ATAK 120 as the AOY Prize! Go to their page give them a like and check out their shop for all of your kayak needs! They are located on Whitewater Park Blvd in Boise! Thanks again Stan and Jo! #fish #fishing #lovefishing #bass #bassfishing #ultraskiff #kayak #jacksonkayak #kayakfishing #fishinglife #goodtimes #fun #largemouthbass #follow #smallmouthbass #oopdeoopfishin #bigbass #bassmaster #2017
Jan 21 Videos Youtube KAYAK FISHING FLORIDA..MY FIRST TUNA!!
Jan 21 Social Instagram Landing back at Deering Point after a great paddle #FLATkayak #kayaking #paddle #adventure #touring #florida #southflorida #miami #biscaynebay #305 #outdoors #wildernesssystems #winter #january #gopro #exercise
Jan 21 Social Instagram Repost from @oopdeoopfishin using @RepostRegramApp - Go check these guys out!! They are puttin on a pretty bad ass yak tourny this year. Repost from @kayakfishingidaho using @RepostRegramApp - We want to welcome Idaho River Sports to the KFI Family as the AOY Title Sponsor. They have Generously donated a Wilderness Systems ATAK 120 as the AOY Prize! Go to their page give them a like and check out their shop for all of your kayak needs! They are located on Whitewater Park Blvd in Boise! Thanks again Stan and Jo! #fish #fishing #lovefishing #bass #bassfishing #ultraskiff #kayak #jacksonkayak #kayakfishing #fishinglife #goodtimes #fun #largemouthbass #follow #smallmouthbass #oopdeoopfishin #bigbass #bassmaster #2017'}}]}, 'config': {'viewer': null, 'csrf_token': 'rIZJZY01LVn3Z3mjQ1tmGhge9dmymlGk'}, 'qe': {'us': {'g': 'continue_vs_signup_text_test_03
Jan 20 Social Instagram Missing my second home #baileysharbor, Summer days and kayaking in Moonlight Bay @doorcounty #wildernesssystems @costasunglasses #seewhatsoutthere #doorcounty #fishing #explore #kayaking #adventure
Jan 20 Social Instagram 26ft swells mean no ocean time this weekend, but I can't wait to get back out there! #wildernesssystems #thresher #wildyfishing #crabbing #gopro #nrs #wernerpaddles #promar #lowrance #herecrabbycrabby #bodega
Jan 20 Social Wilderness Systems Kayaks FB Protecting our public lands means more wild places to paddle! We're proud to endorse this letter to Congress. https://outdoorindustry.org/article/together-can-defend-public-lands/#policy
Jan 19 Social Instagram At least I know I will always have Kayaking buddies now even when it's freezing and I can't get a human to go with me ° They passed their training! Thanks #ozarkmtc for being such an amazing place to shop! Your service is outstanding and we will never shop for Kayaks anywhere else! #OMTC #ThankYou #calicorock #arkansas #kayaks #kayaking #paddleon #bendingbranches #wildernesssystems #winter #arkansaslife #arkmophs #wonderfularkansas #usgram #whiteriver #bluffs #dogsofinstagram #bostonterrier #americanbulldog #getoutside #outintheozarks #thenaturalstate #explorearkansas #obsessed #riveraddict
Jan 19 Social Instagram Be sure to stop by the Appomattox River Co. booth on Saturday and say Hi! #richmondfishingexpo #wernerpaddles #wildernesskayaks #astralbuoyancy #1stlandingguide #kayakfishing @paddleva @wernerpaddles @wildernesssystems @theirangler
Jan 19 Social Wilderness Systems Fishing Kayaks FB Protecting our public lands means more places to fish! We're proud to endorse this letter to Congress. https://outdoorindustry.org/article/together-can-defend-public-lands/#policy
Jan 19 Social Instagram Spring time kayak fishing in Taylor Lake, on the Colorado river. °°#picacho, #picachopeakstatepark, #taylorlake, #kayakfishing, #kayaking, #coloradoriver, #yuma, #lowercoloradoriver, #wildernesssystems, #wildernesssystemskayaks.
Jan 19 Videos Youtube Fishing kayak setup/gear ( wilderness systems atak 140)
Jan 18 Social Wilderness Systems Fishing Kayaks FB A Jeff Little special from Kayak Fish - Click link! - Only for the die hards! #atak140 #atpaddles #wildyfishing http://m.kayakfishmag.com/video-magazine/kfvm9-maintaining-boat-position-wind/
Jan 18 Social Wilderness Systems Fishing Kayaks FB Check out Randy Howell, 2014 Bassmaster Classic Champion and Robin Howell fishing Lake Guntersville in Wilderness Systems A.T.A.K.s! https://www.facebook.com/RandyHowellFishing/
Jan 18 Videos Youtube First bass in the new kayak! Wilderness systems atak 140
Jan 18 Social Instagram Starting the year off with our next Paddler of the Month, Jesse! An avid kayak fisherman, who has gotten comfortable with the Wilderness ATAK 140. Next time you are in the shop man, we'll get you hooked up. Feel free to tag us in your posts with either #canoecountryfl or #ccofl, and you could be the next Paddler of the Month! . . . . . . . . . #wilderness #wildernesssystems #wildernessatak #atak140 #paddlerofmonth #kayak #kayaking #kayakfishing #kayakangler #paddlefishing #florida #stpete #fishing #paddling
Jan 16 Social Instagram I took advantage of a break in the torrential rain we've had lately, to get out on the water with a friend. We couldn't have asked for a nicer winter day out on the #lake. . . . . . . . . . . . #outdoors #takemoreadventures #nature #kayak #kayaking #water #paddle #findyourselfoutside #liveauthentic #wildernesssystems @wildernesssystems
Jan 15 Social Instagram Our new kayak showroom is almost done being built. Everything on display, @feelfreeus @vikingkayaks @nucanoe @wildernesssystems @kakukayak and tons of #SUP too!
Jan 15 Social Instagram Ducks in the mist #wildernesssystems #standuppaddle #valledebravo #paddling #kayak #kayaking
Jan 15 Social Instagram Baby roosters need love too #kayakfishing #splashed #galito #wildernesssystems @wildyfishing @yaktribe @yakattack.us #visicarbon @flyingfishermansunglasses @stohlquistwaterware #puravida #yozuri @yozuri_lures 3.5' 3D popper always gets em !! #kayaking
Jan 14 Social Instagram It's a wildy way of life #puravida #kayaking #kayakfishing #wildernesssystems @wildyfishing @yaktribe #nofilter @yakattack.us
Jan 14 Social Wilderness Systems Fishing Kayaks FB Great review from Chad Hoover on the Wilderness Systems Commander 140 - the canoe-kayak-hybrid fishing machine! #wildyfishing #commander140 https://www.youtube.com/watch?v=u_ZQwFKRceg&feature=youtu.be
Jan 14 Social Instagram Wilderness Systems kayak, $299.99! #kayaking #kayak #greensboro #triadlocalfirst
Jan 14 Social Instagram Manatee encounter DeLeon Springs with @gtrid3r. #florida #kayaking #manatee #wildernesssystems #tarpon100 #tarpon130x #iphonephotography #mobilephotography #phoneonly #outdoors
Jan 14 News unsponsored Paddlesports Industry Coalition Endorses Paddlesports Retailer
Jan 13 Social Instagram #yakattack #kayaking #kayak #ratterrier @ratterriers_ofinstagram @ratterrierworld @welove_ratterriers @wildernesssystems #nature #wildernessculture
Jan 13 Social Instagram What a great day 2 years ago °°°°°° #tarpon100 #kayaking #kayakfishing #addiction #obsessed #passion #wildernesssystems #fishing #angler #bassin #largemouth #scenic #beautiful #shimano #gloomis #stcroix #lews #outdoors #outdoorsman #nature #nj #lake #lifestyle #myescape #mauijim
Jan 13 Social Instagram Not your typical 'yak dog! #wildernesssystems #wildwonderful #kayakingadventures #kayaking #tygartlake #monongahelariver
Jan 13 Social Instagram I few more months til slaying season! °°❤️°°°°#proudboyfriend #girlfriend #angler #fishing #obsessed #lifestyle #addicted #passion #wackyrig #sugarstick #skeetreese #shimano #spinning #fluoro #bassfishing #swampdonkey #slab #bass #lmb #largemouth #outdoors #girlswhofish #kayaking #kayakfishing #wildernesssystems #tarpon100 #merica #usa #nature
Jan 13 Press misc. Paddlesports Coalition Endorses Paddlesports Retailer As Industry's Trade Show - SGB Media (press release) (subscription) (blog)
Jan 13 Social Instagram Stanky smack face !!! Get some ! Mack bite was hot this morning, lost two lures to two biggins but managed this thigh wide for din din #fotosdepesca #costarica #kayakfishing #ceromackerel #playamantas #honeyhole #CROK #costaricaoceankayaking #kayaking #paddle #wildernesssystems #tarpon120 #uglystickgx2 #yozuri @wildyfishing @yaktribe @uglystik @yozuri_lures @theyakangler
Jan 13 Social Instagram #shellkeypreserve #tierraverde #gulfofmexico #kayaks #kayaking #paddling #valleyseakayaks #neckykayaks #wildernesssystems #beach #florida #fun_in_florida #hashtagflorida #igersstpete #lovefl #liveamplified #optoutside #pureflorida #paddlingmixtape #roamflorida #staysaltyflorida #upsideofflorida #waterlust
Jan 12 Social Instagram Jolene's maiden voyage. #florida #outdoors #kayakfishing #kayaking #wildernesssystems #tarpon130x #kayakbassfishing #fishing
Jan 12 Social Instagram I'm caught up in the speed of midterms and all I want to do is go back to one of the chilliest days✌° • • • #nature #kayak #kayaking #paddling #paddlingmixtape #sunset #sunrise #wildernesssystems #dark #schön #kajak #Wisconsin #lake #winter #sunset #nature #naturephotography #landscape #landscapephotogrpahy #optoutside #wilderness #outdoors #rei1440project #explore #photo #photography #explore #escapeandexplore #herbst #northwoods #neverstopexploring #Jillstein #like4like
Jan 12 Social Wilderness Systems Fishing Kayaks FB Master the rewarding skill of winter jigging from a kayak. http://m.kayakfishmag.com/tips/tip-of-the-week/winter-jigging-techniques-for-kayakers/
Jan 11 Social Instagram #lakelucas #kayaking #sunset #wildernesssystems #pamlico
Jan 11 Social Instagram Heading to the office but wishing I was out there paddling #FLATkayak #kayaking #paddle #outdoors #adventure #explore #gopro #miami #southflorida #biscaynebay #florida #nofilter #werner #wildernesssystems
Jan 10 Social Instagram Last second adjustments. I'm not mad, just focused #FLATkayak #kayaking #paddle #gopro #miami #southflorida #florida #biscaynebay #winter #saltlife #wildernesssystems #kayaklyfe #miamidolphins #dolphins
Jan 10 Social Wilderness Systems Fishing Kayaks FB Wildy pro staffer JD Desrosiers snow launches the new Radar 115.
Jan 9 Social Instagram I just got back from kayak camping and island hopping in the Florida Panhandle and can't wait to share the pics! It turns out, adventure can be in your backyard! . Little St. George Island | Florida Panhandle | 1/6/17 . #florida #visitflorida #lovefl #adventure #camping #beach #water #wave #ocean #saltlife #northface #kayaking #kayak #wilderness #island #forgottencoast #camera #gear #nikon @visit_tally @visitflorida @wildernesssystems @thenorthface
Jan 9 Social Instagram Arriving at the launch spot #FLATkayak #kayaking #paddle #adventure #outdoors #yakima #gopro #nofilter #kayakgram #kayaklyfe #saltlife #miami #southflorida #winter #wildernesssystems
Jan 9 Social Instagram I'm proud to announce I am now on Team Filthy. @filthyanglers Check out filthyanglers.com for the best threads in fishing. Use promo code 'filthynick' to receive a sweet discount on your Filthy gear. #fish #fishing #bassfishing #panfishing #crappiefishing #filthyanglers #bassproshop #pline #abugarcia #biwaa #evolutionbaits #luckytacklebox #crappietacklebox #dirtydelta #filthy #dirtbag #bassaholics #hooklineandsinker #wildernesssystems #tarpon120 #kayakfishing #kayaking #certifiedfilthy
Jan 8 Social Instagram #itsatopsulthing #topsailisland #kayaking #paddle #kayak #fishing #paddleti #icw #water #ocean #southern #northcarolina #wildernesssystems #thresher140
Jan 8 Social Instagram #itsatopsulthing #topsailisland #kayaking #paddle #kayak #fishing #paddleti #icw #water #ocean #southern #northcarolina #wildernesssystems #thresher140 #nofilter #tshirt #apparel
Jan 7 Social Instagram A great way to start my last day in Lakeland before the spring semester! #kayaking #lakeland #lakes #wildernesssystems #backtoschool
Jan 7 Videos Youtube Susquehannah River Smallmouth Bass Kayak Fishing Out of a Wilderness Systems ATAK 140
Jan 7 Social Instagram Águila ° #wildernesssystems #standuppaddle #valledebravo #paddling #kayak #kayaking
Jan 7 Social Instagram Paddle, Pedal, and Power, we are thrilled to have the new Wilderness Systems Radar 135! #wildy #wildernesssystems #wildernesssystemsfishingkayaks #kayakcentreri #rhodeisland #paddleRI #kayak #getoutthere #adventure #getoutandplay #kayaking #ocean #paddle #pedal #power #newengland #boat #onthewater #kayakfishing #bassfishing
Jan 7 Social Instagram The new Radar 135 from Wilderness Systems has arrived at the shop! Paddle, peddle, or motor the most versatile kayak to date. Come check it out, we've got the fire going to keep you toasty while you check out the latest kayaks and gear.
Jan 7 Forums /r/kayakfishing seeking advice please!
Jan 7 Social Instagram Kayak life..#kayaking #westernaustralia #wildernesssystems #ocean #sea
Jan 6 News Kayak Angler Magazine Video: New Radar From Wilderness Systems
Jan 6 News Kayak Angler Magazine Boat Review: Wilderness Systems' Tarpon 130x With Helix Drive
Jan 6 News Kayak Angler Magazine Striper Shootout New England Style
Jan 6 News Kayak Angler Magazine Wilderness Systems Award Winning Radar 115
Jan 6 News Kayak Angler Magazine New Kayak Fishing Sponsorship For Randy Howell
Jan 6 News Kayak Angler Magazine Wilderness Systems Releases New A.T.A.K. 120 And Radar
Jan 6 Social Instagram Wilderness Systems' New Radar Family, the first fishing kayak in their lineup to offer effortless motor or pedal drive integration. It's not half bad to paddle either. Check them out! . . . . . . . . #canoecountryfl #wilderness #wildernesssystems #radar #wildernessradar #fishingkayak #fishing #kayaking #paddling #kayakangler #pedal #motor #paddle #pedalkayak #florida #stpete #tampa #clearwater #sarasota
Jan 6 Social Instagram Yakking! #explore #amazing #adventure #adventureisoutthere #getoutside #outdoors #wildernesssystems #getlost #baitcaster #swimbaits #fishing #fishingtrip #kayakbassfishing #kayaking #bassmaster #bassfishing #sunset #sunglasses #smallmouth #dropshot #kvd #13fishing #views #mothernature #naturephotography #glidebait
Jan 5 Forums YakAngler Ride 135 Possible Trade???
Jan 4 Social Instagram I miss the warm weather! #outdoors #wildernessculture #getoutside #explore #mothernature #naturephotography #fishingtrip #fishing #bassfishing #bassmaster #kayaking #kayakbassfishing #largemouthbass #glidebait #pond #baitcaster #droptop #smallmouth #abugarcia #clouds #sunset #summer16 #views #shadows #swimbaits #bigbaits #getlost #wildernesssystems #summer17
Jan 4 Social Instagram My ride!°°° #tarpon100 #kayakbassfishing #kayaking #peacockbass #getoutside #sixgillfishing #trout #swimbaits #bass #bassfishing #bassmaster #wildernessculture #fishing #fishingtrip #smallmouth #wildernesssystems #abugarcia #kvd #droptop #baitcaster #pond #lake #goodtimes #camping #glidebait #outdoors @wildyfishing #tackleWarehouse
Jan 3 Social Instagram Kayak fishing - going where others can't, when others won't, in the pursuit of adventure. #kayak #kayakfishing #fishing #kayakangler #jacksonkayak #wildernesssystems #scottyfishing #kayakbassin #catfish #bass #bassfishing #ohiofishing #gofishing #coosa #tarpon120 #yakattack #winterfishing #berkleyfishing #luckytacklebox #allprorods #lews #lewsreels #shimano #shimanofishing #winter #determination @frank_teague
Jan 2 Social Instagram Superman has his cape. I have a drysuit. ° . . . . . . . . #lifeofadventure #winterkayaking #churchofthedoublebladedpaddle #livingthedream #winter #snow #kayak #kayaking #paddle #paddling #livingthedreamadventures #kokatat #nrs #wildernesssystems #wernerpaddles #westsalem #wisconsin #adventure #exploring #explore #ccakc #drysuit #happynewyear #newyear #newyearsday
Jan 2 Social Instagram Happy New year °°#ocean #kayaking #westernaustralia #wildernesssystems #island #sea #beach #islandlife
Jan 2 Social Instagram Starting off 2017 right! #FLATkayak #kayaking #2017 #paddle #miami #southflorida #biscaynebay #mangroves #wildernesssystems #zephyr160 #gopro #aventures #outdoorlife #kayaklyfe
Jan 2 Social Instagram A closer look at the seating system on the @perceptionkayak Pescador pilot 12.0 pedal drive kayak. Super easy adjustment system utilizing a track system on the center console and two adjustment knobs. #wildernesssystems #iphone #quiversports #quiver_sports #goprohero5 #kayakfishing #kayaking #pedaldrive #perceptionkayaks #confluenceoutdoors #kayaking #2017 #happynewyear #sonar #midnightblue
Jan 2 Social Instagram The kayaks get their own boat slip off the canal. #floridakeys #bigpinekey #wildernesssystems #kayaking
Jan 1 Social Instagram So far my #2017 #exercise schedule is perfect!° I did a 5.4 mile #paddle in the #kayak, fighting the wind in the #intercoastalwaterway then went for a three mile walk to the beach with Jennifer of @amazingstreetpainting. The high light was seeing an otter in the Intercoastal. Fantastic, but windy weather in #southflorida for #newyearsday. What did you do today? Let us know by writing a comment below. Let 2017 be great. #happynewyear #kayaking #paddling #currentdesigns ##boating #funoutdoors #floridaoutside #floridaliving #floridaoutdoors #funinthesun #floridafun #sunshinestate #sunshineandfreshair #oldtowncanoe #wildernesssystems
Jan 1 Social Instagram Today's Paddle on Skidaway River!!! #skidawayisland #skidawayriver #kayaklife #kayaking #paddlingga #paddlelife #perceptionkayaks #wildernesssystems #tsunami175 #carolina14
Jan 1 Social Instagram Skidaway River!! #kayaking #kayaklife #kayakgram #paddlingga #skidawayisland #skidawayriver #wildernesssystems #tsunami175

Add your name or brand to The Playak Factor


Name or Brand:

Main sport:

E-mail:

Comments (e.g. questions, blog addresses, team info):

Questions about The Playak Factor?

If you need further information about this service, please ask by filling in this form.

Topic:

E-mail:

Question:

Surfrider Foundation
See the AUP for our Acceptable Use Policy and a Privacy Statement. Verein Playak is responsible for all editorial content on this site (including all graphics). No part of this site may be duplicated in any way without explicit permission from Verein Playak. Verein Playak takes great care to only publish original content, but since part of the content is user generated, we cannot always guarantee this 100%. If you notice any copyright violations, please let the editors know through the contact form and they will take appropriate action immediately. As a news and information platform, we republish small text snippets and thumbnail images, but always link to original content on other sites, and thus aim to adhere to a 'Fair Use' policy. If you believe we violate this policy in any particular case, please contact us directly and we'll take appropriate action immediately.